https://launchpad.net/ubuntu/+source/fasta3/36.3.8h.2020-02-11-4/+build/22293620 RUN: /usr/share/launchpad-buildd/bin/builder-prep Kernel version: Linux bos02-arm64-054 4.15.0-159-generic #167-Ubuntu SMP Mon Sep 20 23:06:52 UTC 2021 aarch64 Buildd toolchain package versions: launchpad-buildd_203~505~ubuntu18.04.1 python3-lpbuildd_203~505~ubuntu18.04.1 sbuild_0.75.0-1ubuntu1 bzr-builder_0.7.3+bzr174~ppa13~ubuntu16.04.1 bzr_2.7.0+bzr6622-10 git-build-recipe_0.3.6~git201906051340.ff11471~ubuntu18.04.1 git_1:2.17.1-1ubuntu0.9 dpkg-dev_1.19.0.5ubuntu2.3 python-debian_0.1.32 python3-debian_0.1.32. Syncing the system clock with the buildd NTP service... 19 Oct 22:39:29 ntpdate[1691]: adjust time server 10.211.37.1 offset 0.005135 sec RUN: /usr/share/launchpad-buildd/bin/in-target unpack-chroot --backend=chroot --series=jammy --arch=armhf PACKAGEBUILD-22293620 --image-type chroot /home/buildd/filecache-default/679b34c61ac674bf7a7b60a9cca5f3e60877d1fc Creating target for build PACKAGEBUILD-22293620 RUN: /usr/share/launchpad-buildd/bin/in-target mount-chroot --backend=chroot --series=jammy --arch=armhf PACKAGEBUILD-22293620 Starting target for build PACKAGEBUILD-22293620 RUN: /usr/share/launchpad-buildd/bin/in-target override-sources-list --backend=chroot --series=jammy --arch=armhf PACKAGEBUILD-22293620 'deb http://ftpmaster.internal/ubuntu jammy main restricted universe multiverse' 'deb http://ftpmaster.internal/ubuntu jammy-security main restricted universe multiverse' 'deb http://ftpmaster.internal/ubuntu jammy-updates main restricted universe multiverse' 'deb http://ftpmaster.internal/ubuntu jammy-proposed main restricted universe multiverse' Overriding sources.list in build-PACKAGEBUILD-22293620 RUN: /usr/share/launchpad-buildd/bin/in-target update-debian-chroot --backend=chroot --series=jammy --arch=armhf PACKAGEBUILD-22293620 Updating target for build PACKAGEBUILD-22293620 Get:1 http://ftpmaster.internal/ubuntu jammy InRelease [224 kB] Get:2 http://ftpmaster.internal/ubuntu jammy-security InRelease [74.9 kB] Get:3 http://ftpmaster.internal/ubuntu jammy-updates InRelease [74.9 kB] Get:4 http://ftpmaster.internal/ubuntu jammy-proposed InRelease [74.9 kB] Get:5 http://ftpmaster.internal/ubuntu jammy/main armhf Packages [1351 kB] Get:6 http://ftpmaster.internal/ubuntu jammy/main Translation-en [512 kB] Get:7 http://ftpmaster.internal/ubuntu jammy/restricted armhf Packages [9728 B] Get:8 http://ftpmaster.internal/ubuntu jammy/restricted Translation-en [13.0 kB] Get:9 http://ftpmaster.internal/ubuntu jammy/universe armhf Packages [12.6 MB] Get:10 http://ftpmaster.internal/ubuntu jammy/universe Translation-en [5463 kB] Get:11 http://ftpmaster.internal/ubuntu jammy/multiverse armhf Packages [161 kB] Get:12 http://ftpmaster.internal/ubuntu jammy/multiverse Translation-en [108 kB] Get:13 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf Packages [257 kB] Get:14 http://ftpmaster.internal/ubuntu jammy-proposed/main Translation-en [99.9 kB] Get:15 http://ftpmaster.internal/ubuntu jammy-proposed/restricted armhf Packages [752 B] Get:16 http://ftpmaster.internal/ubuntu jammy-proposed/restricted Translation-en [2172 B] Get:17 http://ftpmaster.internal/ubuntu jammy-proposed/universe armhf Packages [2054 kB] Get:18 http://ftpmaster.internal/ubuntu jammy-proposed/universe Translation-en [1073 kB] Get:19 http://ftpmaster.internal/ubuntu jammy-proposed/multiverse armhf Packages [16.5 kB] Get:20 http://ftpmaster.internal/ubuntu jammy-proposed/multiverse Translation-en [23.1 kB] Fetched 24.2 MB in 8s (2877 kB/s) Reading package lists... Reading package lists... Building dependency tree... Reading state information... Calculating upgrade... The following packages will be upgraded: apt base-files base-passwd bsdutils bzip2 ca-certificates coreutils debianutils fakeroot gzip libapparmor1 libapt-pkg6.0 libargon2-1 libattr1 libaudit-common libaudit1 libblkid1 libbz2-1.0 libcap-ng0 libcap2 libcrypt-dev libcrypt1 libdb5.3 libdebconfclient0 libfakeroot libgdbm-compat4 libgdbm6 libgmp10 libgpg-error0 libgssapi-krb5-2 libhogweed6 libidn2-0 libip4tc2 libisl23 libjson-c5 libk5crypto3 libkeyutils1 libkrb5-3 libkrb5support0 liblz4-1 liblzma5 libmount1 libmpc3 libmpfr6 libncurses6 libncursesw6 libnettle8 libnpth0 libp11-kit0 libpcre3 libreadline8 libseccomp2 libselinux1 libsemanage-common libsemanage1 libsmartcols1 libsqlite3-0 libtasn1-6 libtinfo6 libuuid1 libzstd1 lockfile-progs make mawk mount ncurses-base ncurses-bin optipng patch pinentry-curses readline-common sed sensible-utils sysvinit-utils tar util-linux xz-utils 77 upgraded, 0 newly installed, 0 to remove and 0 not upgraded. Need to get 12.5 MB of archives. After this operation, 25.6 kB disk space will be freed. Get:1 http://ftpmaster.internal/ubuntu jammy/main armhf libcrypt-dev armhf 1:4.4.18-4ubuntu2 [122 kB] Get:2 http://ftpmaster.internal/ubuntu jammy/main armhf libcrypt1 armhf 1:4.4.18-4ubuntu2 [94.2 kB] Get:3 http://ftpmaster.internal/ubuntu jammy/main armhf base-files armhf 12ubuntu1 [63.0 kB] Get:4 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf bsdutils armhf 1:2.36.1-8ubuntu2 [86.0 kB] Get:5 http://ftpmaster.internal/ubuntu jammy/main armhf coreutils armhf 8.32-4ubuntu3 [1302 kB] Get:6 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf debianutils armhf 5.5-1 [76.9 kB] Get:7 http://ftpmaster.internal/ubuntu jammy/main armhf gzip armhf 1.10-4ubuntu2 [94.9 kB] Get:8 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libncurses6 armhf 6.2+20210905-1 [87.4 kB] Get:9 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libncursesw6 armhf 6.2+20210905-1 [118 kB] Get:10 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libtinfo6 armhf 6.2+20210905-1 [88.3 kB] Get:11 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf ncurses-bin armhf 6.2+20210905-1 [172 kB] Get:12 http://ftpmaster.internal/ubuntu jammy/main armhf sed armhf 4.7-1ubuntu2 [185 kB] Get:13 http://ftpmaster.internal/ubuntu jammy/main armhf tar armhf 1.34+dfsg-1build2 [272 kB] Get:14 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf util-linux armhf 2.36.1-8ubuntu2 [1071 kB] Get:15 http://ftpmaster.internal/ubuntu jammy/main armhf libdebconfclient0 armhf 0.256ubuntu4 [5802 B] Get:16 http://ftpmaster.internal/ubuntu jammy/main armhf base-passwd armhf 3.5.52 [49.1 kB] Get:17 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf ncurses-base all 6.2+20210905-1 [19.9 kB] Get:18 http://ftpmaster.internal/ubuntu jammy/main armhf sysvinit-utils armhf 2.96-7ubuntu2 [20.1 kB] Get:19 http://ftpmaster.internal/ubuntu jammy/main armhf bzip2 armhf 1.0.8-4ubuntu4 [34.1 kB] Get:20 http://ftpmaster.internal/ubuntu jammy/main armhf libbz2-1.0 armhf 1.0.8-4ubuntu4 [31.4 kB] Get:21 http://ftpmaster.internal/ubuntu jammy/main armhf liblz4-1 armhf 1.9.3-2build1 [54.9 kB] Get:22 http://ftpmaster.internal/ubuntu jammy/main armhf liblzma5 armhf 5.2.5-2build1 [87.3 kB] Get:23 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libzstd1 armhf 1.4.8+dfsg-3 [285 kB] Get:24 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libapt-pkg6.0 armhf 2.3.10 [897 kB] Get:25 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libseccomp2 armhf 2.5.1-1ubuntu2 [47.5 kB] Get:26 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf apt armhf 2.3.10 [1380 kB] Get:27 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf mount armhf 2.36.1-8ubuntu2 [122 kB] Get:28 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libattr1 armhf 1:2.5.1-1 [12.2 kB] Get:29 http://ftpmaster.internal/ubuntu jammy/main armhf libaudit-common all 1:3.0-2ubuntu3 [4688 B] Get:30 http://ftpmaster.internal/ubuntu jammy/main armhf libcap-ng0 armhf 0.7.9-2.2build2 [10.1 kB] Get:31 http://ftpmaster.internal/ubuntu jammy/main armhf libaudit1 armhf 1:3.0-2ubuntu3 [43.1 kB] Get:32 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libblkid1 armhf 2.36.1-8ubuntu2 [131 kB] Get:33 http://ftpmaster.internal/ubuntu jammy/main armhf libcap2 armhf 1:2.44-1build2 [15.3 kB] Get:34 http://ftpmaster.internal/ubuntu jammy/main armhf libdb5.3 armhf 5.3.28+dfsg1-0.8ubuntu2 [648 kB] Get:35 http://ftpmaster.internal/ubuntu jammy/main armhf libgmp10 armhf 2:6.2.1+dfsg-1ubuntu3 [207 kB] Get:36 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libgpg-error0 armhf 1.42-3 [60.1 kB] Get:37 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libk5crypto3 armhf 1.18.3-7 [83.1 kB] Get:38 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libkrb5support0 armhf 1.18.3-7 [30.3 kB] Get:39 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libkrb5-3 armhf 1.18.3-7 [330 kB] Get:40 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libgssapi-krb5-2 armhf 1.18.3-7 [120 kB] Get:41 http://ftpmaster.internal/ubuntu jammy/main armhf libkeyutils1 armhf 1.6.1-2ubuntu2 [8936 B] Get:42 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libselinux1 armhf 3.1-3build3 [66.4 kB] Get:43 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libmount1 armhf 2.36.1-8ubuntu2 [146 kB] Get:44 http://ftpmaster.internal/ubuntu jammy/main armhf libpcre3 armhf 2:8.39-13build4 [225 kB] Get:45 http://ftpmaster.internal/ubuntu jammy/main armhf libsemanage-common all 3.1-1ubuntu3 [9606 B] Get:46 http://ftpmaster.internal/ubuntu jammy/main armhf libsemanage1 armhf 3.1-1ubuntu3 [83.9 kB] Get:47 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libsmartcols1 armhf 2.36.1-8ubuntu2 [90.9 kB] Get:48 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libuuid1 armhf 2.36.1-8ubuntu2 [22.7 kB] Get:49 http://ftpmaster.internal/ubuntu jammy/main armhf libnettle8 armhf 3.7.3-1build1 [173 kB] Get:50 http://ftpmaster.internal/ubuntu jammy/main armhf libhogweed6 armhf 3.7.3-1build1 [187 kB] Get:51 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libidn2-0 armhf 2.3.2-2 [67.8 kB] Get:52 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libp11-kit0 armhf 0.24.0-5 [218 kB] Get:53 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libtasn1-6 armhf 4.17.0-2 [36.6 kB] Get:54 http://ftpmaster.internal/ubuntu jammy/main armhf mawk armhf 1.3.4.20200120-2build1 [91.4 kB] Get:55 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf sensible-utils all 0.0.17 [20.1 kB] Get:56 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf ca-certificates all 20211016 [148 kB] Get:57 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libapparmor1 armhf 3.0.3-0ubuntu2 [32.2 kB] Get:58 http://ftpmaster.internal/ubuntu jammy/main armhf libargon2-1 armhf 0~20171227-0.2build22 [20.9 kB] Get:59 http://ftpmaster.internal/ubuntu jammy/main armhf libip4tc2 armhf 1.8.7-1ubuntu3 [17.6 kB] Get:60 http://ftpmaster.internal/ubuntu jammy/main armhf libjson-c5 armhf 0.15-2build3 [28.9 kB] Get:61 http://ftpmaster.internal/ubuntu jammy/main armhf readline-common all 8.1-2build1 [53.6 kB] Get:62 http://ftpmaster.internal/ubuntu jammy/main armhf libreadline8 armhf 8.1-2build1 [128 kB] Get:63 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libsqlite3-0 armhf 3.36.0-2 [571 kB] Get:64 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libgdbm6 armhf 1.21-1 [30.9 kB] Get:65 http://ftpmaster.internal/ubuntu jammy/main armhf xz-utils armhf 5.2.5-2build1 [84.4 kB] Get:66 http://ftpmaster.internal/ubuntu jammy/main armhf libfakeroot armhf 1.25.3-1.1ubuntu3 [26.2 kB] Get:67 http://ftpmaster.internal/ubuntu jammy/main armhf fakeroot armhf 1.25.3-1.1ubuntu3 [62.2 kB] Get:68 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libgdbm-compat4 armhf 1.21-1 [6120 B] Get:69 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libisl23 armhf 0.24-2 [581 kB] Get:70 http://ftpmaster.internal/ubuntu jammy/main armhf libmpfr6 armhf 4.1.0-3build2 [217 kB] Get:71 http://ftpmaster.internal/ubuntu jammy/main armhf libnpth0 armhf 1.6-3build1 [7254 B] Get:72 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf lockfile-progs armhf 0.1.19 [9508 B] Get:73 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf make armhf 4.3-4ubuntu2 [162 kB] Get:74 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf optipng armhf 0.7.7-2 [84.7 kB] Get:75 http://ftpmaster.internal/ubuntu jammy/main armhf patch armhf 2.7.6-7build1 [111 kB] Get:76 http://ftpmaster.internal/ubuntu jammy/main armhf pinentry-curses armhf 1.1.1-1build1 [35.6 kB] Get:77 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libmpc3 armhf 1.2.1-1 [39.5 kB] debconf: delaying package configuration, since apt-utils is not installed Fetched 12.5 MB in 2s (6777 kB/s) (Reading database ... 12985 files and directories currently installed.) Preparing to unpack .../libcrypt-dev_1%3a4.4.18-4ubuntu2_armhf.deb ... Unpacking libcrypt-dev:armhf (1:4.4.18-4ubuntu2) over (1:4.4.18-4ubuntu1) ... Preparing to unpack .../libcrypt1_1%3a4.4.18-4ubuntu2_armhf.deb ... Unpacking libcrypt1:armhf (1:4.4.18-4ubuntu2) over (1:4.4.18-4ubuntu1) ... Setting up libcrypt1:armhf (1:4.4.18-4ubuntu2) ... (Reading database ... 12985 files and directories currently installed.) Preparing to unpack .../base-files_12ubuntu1_armhf.deb ... Unpacking base-files (12ubuntu1) over (11.1ubuntu5) ... Setting up base-files (12ubuntu1) ... Installing new version of config file /etc/debian_version ... Installing new version of config file /etc/issue ... Installing new version of config file /etc/issue.net ... Installing new version of config file /etc/lsb-release ... (Reading database ... 12985 files and directories currently installed.) Preparing to unpack .../bsdutils_1%3a2.36.1-8ubuntu2_armhf.deb ... Unpacking bsdutils (1:2.36.1-8ubuntu2) over (1:2.36.1-8ubuntu1) ... Setting up bsdutils (1:2.36.1-8ubuntu2) ... (Reading database ... 12985 files and directories currently installed.) Preparing to unpack .../coreutils_8.32-4ubuntu3_armhf.deb ... Unpacking coreutils (8.32-4ubuntu3) over (8.32-4ubuntu2) ... Setting up coreutils (8.32-4ubuntu3) ... (Reading database ... 12985 files and directories currently installed.) Preparing to unpack .../debianutils_5.5-1_armhf.deb ... Unpacking debianutils (5.5-1) over (4.11.2) ... Setting up debianutils (5.5-1) ... update-alternatives: using /usr/bin/which.debianutils to provide /usr/bin/which (which) in auto mode (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../gzip_1.10-4ubuntu2_armhf.deb ... Unpacking gzip (1.10-4ubuntu2) over (1.10-4ubuntu1) ... Setting up gzip (1.10-4ubuntu2) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libncurses6_6.2+20210905-1_armhf.deb ... Unpacking libncurses6:armhf (6.2+20210905-1) over (6.2+20201114-2build1) ... Preparing to unpack .../libncursesw6_6.2+20210905-1_armhf.deb ... Unpacking libncursesw6:armhf (6.2+20210905-1) over (6.2+20201114-2build1) ... Preparing to unpack .../libtinfo6_6.2+20210905-1_armhf.deb ... Unpacking libtinfo6:armhf (6.2+20210905-1) over (6.2+20201114-2build1) ... Setting up libtinfo6:armhf (6.2+20210905-1) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../ncurses-bin_6.2+20210905-1_armhf.deb ... Unpacking ncurses-bin (6.2+20210905-1) over (6.2+20201114-2build1) ... Setting up ncurses-bin (6.2+20210905-1) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../sed_4.7-1ubuntu2_armhf.deb ... Unpacking sed (4.7-1ubuntu2) over (4.7-1ubuntu1) ... Setting up sed (4.7-1ubuntu2) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../tar_1.34+dfsg-1build2_armhf.deb ... Unpacking tar (1.34+dfsg-1build2) over (1.34+dfsg-1build1) ... Setting up tar (1.34+dfsg-1build2) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../util-linux_2.36.1-8ubuntu2_armhf.deb ... Unpacking util-linux (2.36.1-8ubuntu2) over (2.36.1-8ubuntu1) ... Setting up util-linux (2.36.1-8ubuntu2) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libdebconfclient0_0.256ubuntu4_armhf.deb ... Unpacking libdebconfclient0:armhf (0.256ubuntu4) over (0.256ubuntu3) ... Setting up libdebconfclient0:armhf (0.256ubuntu4) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../base-passwd_3.5.52_armhf.deb ... Unpacking base-passwd (3.5.52) over (3.5.51) ... Setting up base-passwd (3.5.52) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../ncurses-base_6.2+20210905-1_all.deb ... Unpacking ncurses-base (6.2+20210905-1) over (6.2+20201114-2build1) ... Setting up ncurses-base (6.2+20210905-1) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../sysvinit-utils_2.96-7ubuntu2_armhf.deb ... Unpacking sysvinit-utils (2.96-7ubuntu2) over (2.96-7ubuntu1) ... Setting up sysvinit-utils (2.96-7ubuntu2) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../bzip2_1.0.8-4ubuntu4_armhf.deb ... Unpacking bzip2 (1.0.8-4ubuntu4) over (1.0.8-4ubuntu3) ... Preparing to unpack .../libbz2-1.0_1.0.8-4ubuntu4_armhf.deb ... Unpacking libbz2-1.0:armhf (1.0.8-4ubuntu4) over (1.0.8-4ubuntu3) ... Setting up libbz2-1.0:armhf (1.0.8-4ubuntu4) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../liblz4-1_1.9.3-2build1_armhf.deb ... Unpacking liblz4-1:armhf (1.9.3-2build1) over (1.9.3-2) ... Setting up liblz4-1:armhf (1.9.3-2build1) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../liblzma5_5.2.5-2build1_armhf.deb ... Unpacking liblzma5:armhf (5.2.5-2build1) over (5.2.5-2) ... Setting up liblzma5:armhf (5.2.5-2build1) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libzstd1_1.4.8+dfsg-3_armhf.deb ... Unpacking libzstd1:armhf (1.4.8+dfsg-3) over (1.4.8+dfsg-2.1) ... Setting up libzstd1:armhf (1.4.8+dfsg-3) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libapt-pkg6.0_2.3.10_armhf.deb ... Unpacking libapt-pkg6.0:armhf (2.3.10) over (2.3.9) ... Setting up libapt-pkg6.0:armhf (2.3.10) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libseccomp2_2.5.1-1ubuntu2_armhf.deb ... Unpacking libseccomp2:armhf (2.5.1-1ubuntu2) over (2.5.1-1ubuntu1) ... Setting up libseccomp2:armhf (2.5.1-1ubuntu2) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../archives/apt_2.3.10_armhf.deb ... Unpacking apt (2.3.10) over (2.3.9) ... Setting up apt (2.3.10) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../mount_2.36.1-8ubuntu2_armhf.deb ... Unpacking mount (2.36.1-8ubuntu2) over (2.36.1-8ubuntu1) ... Preparing to unpack .../libattr1_1%3a2.5.1-1_armhf.deb ... Unpacking libattr1:armhf (1:2.5.1-1) over (1:2.4.48-6build2) ... Setting up libattr1:armhf (1:2.5.1-1) ... Installing new version of config file /etc/xattr.conf ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libaudit-common_1%3a3.0-2ubuntu3_all.deb ... Unpacking libaudit-common (1:3.0-2ubuntu3) over (1:3.0-2ubuntu2) ... Setting up libaudit-common (1:3.0-2ubuntu3) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libcap-ng0_0.7.9-2.2build2_armhf.deb ... Unpacking libcap-ng0:armhf (0.7.9-2.2build2) over (0.7.9-2.2build1) ... Setting up libcap-ng0:armhf (0.7.9-2.2build2) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libaudit1_1%3a3.0-2ubuntu3_armhf.deb ... Unpacking libaudit1:armhf (1:3.0-2ubuntu3) over (1:3.0-2ubuntu2) ... Setting up libaudit1:armhf (1:3.0-2ubuntu3) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libblkid1_2.36.1-8ubuntu2_armhf.deb ... Unpacking libblkid1:armhf (2.36.1-8ubuntu2) over (2.36.1-8ubuntu1) ... Setting up libblkid1:armhf (2.36.1-8ubuntu2) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libcap2_1%3a2.44-1build2_armhf.deb ... Unpacking libcap2:armhf (1:2.44-1build2) over (1:2.44-1build1) ... Setting up libcap2:armhf (1:2.44-1build2) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libdb5.3_5.3.28+dfsg1-0.8ubuntu2_armhf.deb ... Unpacking libdb5.3:armhf (5.3.28+dfsg1-0.8ubuntu2) over (5.3.28+dfsg1-0.8ubuntu1) ... Setting up libdb5.3:armhf (5.3.28+dfsg1-0.8ubuntu2) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libgmp10_2%3a6.2.1+dfsg-1ubuntu3_armhf.deb ... Unpacking libgmp10:armhf (2:6.2.1+dfsg-1ubuntu3) over (2:6.2.1+dfsg-1ubuntu2) ... Setting up libgmp10:armhf (2:6.2.1+dfsg-1ubuntu3) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libgpg-error0_1.42-3_armhf.deb ... Unpacking libgpg-error0:armhf (1.42-3) over (1.38-2build1) ... Setting up libgpg-error0:armhf (1.42-3) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libk5crypto3_1.18.3-7_armhf.deb ... Unpacking libk5crypto3:armhf (1.18.3-7) over (1.18.3-6) ... Setting up libk5crypto3:armhf (1.18.3-7) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libkrb5support0_1.18.3-7_armhf.deb ... Unpacking libkrb5support0:armhf (1.18.3-7) over (1.18.3-6) ... Setting up libkrb5support0:armhf (1.18.3-7) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libkrb5-3_1.18.3-7_armhf.deb ... Unpacking libkrb5-3:armhf (1.18.3-7) over (1.18.3-6) ... Setting up libkrb5-3:armhf (1.18.3-7) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libgssapi-krb5-2_1.18.3-7_armhf.deb ... Unpacking libgssapi-krb5-2:armhf (1.18.3-7) over (1.18.3-6) ... Setting up libgssapi-krb5-2:armhf (1.18.3-7) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libkeyutils1_1.6.1-2ubuntu2_armhf.deb ... Unpacking libkeyutils1:armhf (1.6.1-2ubuntu2) over (1.6.1-2ubuntu1) ... Setting up libkeyutils1:armhf (1.6.1-2ubuntu2) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libselinux1_3.1-3build3_armhf.deb ... Unpacking libselinux1:armhf (3.1-3build3) over (3.1-3build2) ... Setting up libselinux1:armhf (3.1-3build3) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libmount1_2.36.1-8ubuntu2_armhf.deb ... Unpacking libmount1:armhf (2.36.1-8ubuntu2) over (2.36.1-8ubuntu1) ... Setting up libmount1:armhf (2.36.1-8ubuntu2) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libpcre3_2%3a8.39-13build4_armhf.deb ... Unpacking libpcre3:armhf (2:8.39-13build4) over (2:8.39-13build3) ... Setting up libpcre3:armhf (2:8.39-13build4) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libsemanage-common_3.1-1ubuntu3_all.deb ... Unpacking libsemanage-common (3.1-1ubuntu3) over (3.1-1ubuntu2) ... Setting up libsemanage-common (3.1-1ubuntu3) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libsemanage1_3.1-1ubuntu3_armhf.deb ... Unpacking libsemanage1:armhf (3.1-1ubuntu3) over (3.1-1ubuntu2) ... Setting up libsemanage1:armhf (3.1-1ubuntu3) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libsmartcols1_2.36.1-8ubuntu2_armhf.deb ... Unpacking libsmartcols1:armhf (2.36.1-8ubuntu2) over (2.36.1-8ubuntu1) ... Setting up libsmartcols1:armhf (2.36.1-8ubuntu2) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libuuid1_2.36.1-8ubuntu2_armhf.deb ... Unpacking libuuid1:armhf (2.36.1-8ubuntu2) over (2.36.1-8ubuntu1) ... Setting up libuuid1:armhf (2.36.1-8ubuntu2) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libnettle8_3.7.3-1build1_armhf.deb ... Unpacking libnettle8:armhf (3.7.3-1build1) over (3.7.3-1) ... Setting up libnettle8:armhf (3.7.3-1build1) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libhogweed6_3.7.3-1build1_armhf.deb ... Unpacking libhogweed6:armhf (3.7.3-1build1) over (3.7.3-1) ... Setting up libhogweed6:armhf (3.7.3-1build1) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libidn2-0_2.3.2-2_armhf.deb ... Unpacking libidn2-0:armhf (2.3.2-2) over (2.3.1-1) ... Setting up libidn2-0:armhf (2.3.2-2) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libp11-kit0_0.24.0-5_armhf.deb ... Unpacking libp11-kit0:armhf (0.24.0-5) over (0.23.22-1build1) ... Setting up libp11-kit0:armhf (0.24.0-5) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../libtasn1-6_4.17.0-2_armhf.deb ... Unpacking libtasn1-6:armhf (4.17.0-2) over (4.16.0-2) ... Setting up libtasn1-6:armhf (4.17.0-2) ... (Reading database ... 12980 files and directories currently installed.) Preparing to unpack .../00-mawk_1.3.4.20200120-2build1_armhf.deb ... Unpacking mawk (1.3.4.20200120-2build1) over (1.3.4.20200120-2) ... Preparing to unpack .../01-sensible-utils_0.0.17_all.deb ... Unpacking sensible-utils (0.0.17) over (0.0.14) ... Preparing to unpack .../02-ca-certificates_20211016_all.deb ... Unpacking ca-certificates (20211016) over (20210119ubuntu1) ... Preparing to unpack .../03-libapparmor1_3.0.3-0ubuntu2_armhf.deb ... Unpacking libapparmor1:armhf (3.0.3-0ubuntu2) over (3.0.3-0ubuntu1) ... Preparing to unpack .../04-libargon2-1_0~20171227-0.2build22_armhf.deb ... Unpacking libargon2-1:armhf (0~20171227-0.2build22) over (0~20171227-0.2build21.04.0) ... Preparing to unpack .../05-libip4tc2_1.8.7-1ubuntu3_armhf.deb ... Unpacking libip4tc2:armhf (1.8.7-1ubuntu3) over (1.8.7-1ubuntu2) ... Preparing to unpack .../06-libjson-c5_0.15-2build3_armhf.deb ... Unpacking libjson-c5:armhf (0.15-2build3) over (0.15-2build2) ... Preparing to unpack .../07-readline-common_8.1-2build1_all.deb ... Unpacking readline-common (8.1-2build1) over (8.1-2) ... Preparing to unpack .../08-libreadline8_8.1-2build1_armhf.deb ... Unpacking libreadline8:armhf (8.1-2build1) over (8.1-2) ... Preparing to unpack .../09-libsqlite3-0_3.36.0-2_armhf.deb ... Unpacking libsqlite3-0:armhf (3.36.0-2) over (3.35.5-1) ... Preparing to unpack .../10-libgdbm6_1.21-1_armhf.deb ... Unpacking libgdbm6:armhf (1.21-1) over (1.19-2) ... Preparing to unpack .../11-xz-utils_5.2.5-2build1_armhf.deb ... Unpacking xz-utils (5.2.5-2build1) over (5.2.5-2) ... Preparing to unpack .../12-libfakeroot_1.25.3-1.1ubuntu3_armhf.deb ... Unpacking libfakeroot:armhf (1.25.3-1.1ubuntu3) over (1.25.3-1.1ubuntu2) ... Preparing to unpack .../13-fakeroot_1.25.3-1.1ubuntu3_armhf.deb ... Unpacking fakeroot (1.25.3-1.1ubuntu3) over (1.25.3-1.1ubuntu2) ... Preparing to unpack .../14-libgdbm-compat4_1.21-1_armhf.deb ... Unpacking libgdbm-compat4:armhf (1.21-1) over (1.19-2) ... Preparing to unpack .../15-libisl23_0.24-2_armhf.deb ... Unpacking libisl23:armhf (0.24-2) over (0.24-1) ... Preparing to unpack .../16-libmpfr6_4.1.0-3build2_armhf.deb ... Unpacking libmpfr6:armhf (4.1.0-3build2) over (4.1.0-3build1) ... Preparing to unpack .../17-libnpth0_1.6-3build1_armhf.deb ... Unpacking libnpth0:armhf (1.6-3build1) over (1.6-3) ... Preparing to unpack .../18-lockfile-progs_0.1.19_armhf.deb ... Unpacking lockfile-progs (0.1.19) over (0.1.18build1) ... Preparing to unpack .../19-make_4.3-4ubuntu2_armhf.deb ... Unpacking make (4.3-4ubuntu2) over (4.3-4ubuntu1) ... Preparing to unpack .../20-optipng_0.7.7-2_armhf.deb ... Unpacking optipng (0.7.7-2) over (0.7.7-1build1) ... Preparing to unpack .../21-patch_2.7.6-7build1_armhf.deb ... Unpacking patch (2.7.6-7build1) over (2.7.6-7) ... Preparing to unpack .../22-pinentry-curses_1.1.1-1build1_armhf.deb ... Unpacking pinentry-curses (1.1.1-1build1) over (1.1.1-1) ... Preparing to unpack .../23-libmpc3_1.2.1-1_armhf.deb ... Unpacking libmpc3:armhf (1.2.1-1) over (1.2.0-1build1) ... Setting up libip4tc2:armhf (1.8.7-1ubuntu3) ... Setting up libapparmor1:armhf (3.0.3-0ubuntu2) ... Setting up libargon2-1:armhf (0~20171227-0.2build22) ... Setting up libsqlite3-0:armhf (3.36.0-2) ... Setting up libnpth0:armhf (1.6-3build1) ... Setting up bzip2 (1.0.8-4ubuntu4) ... Setting up libfakeroot:armhf (1.25.3-1.1ubuntu3) ... Setting up fakeroot (1.25.3-1.1ubuntu3) ... Setting up ca-certificates (20211016) ... Updating certificates in /etc/ssl/certs... rehash: warning: skipping ca-certificates.crt,it does not contain exactly one certificate or CRL 7 added, 8 removed; done. Setting up make (4.3-4ubuntu2) ... Setting up libmpfr6:armhf (4.1.0-3build2) ... Setting up optipng (0.7.7-2) ... Setting up libncurses6:armhf (6.2+20210905-1) ... Setting up xz-utils (5.2.5-2build1) ... Setting up libmpc3:armhf (1.2.1-1) ... Setting up lockfile-progs (0.1.19) ... Setting up patch (2.7.6-7build1) ... Setting up libncursesw6:armhf (6.2+20210905-1) ... Setting up mount (2.36.1-8ubuntu2) ... Setting up sensible-utils (0.0.17) ... Setting up libcrypt-dev:armhf (1:4.4.18-4ubuntu2) ... Setting up mawk (1.3.4.20200120-2build1) ... Setting up libisl23:armhf (0.24-2) ... Setting up libjson-c5:armhf (0.15-2build3) ... Setting up readline-common (8.1-2build1) ... Setting up libgdbm6:armhf (1.21-1) ... Setting up pinentry-curses (1.1.1-1build1) ... Setting up libreadline8:armhf (8.1-2build1) ... Setting up libgdbm-compat4:armhf (1.21-1) ... Processing triggers for libc-bin (2.34-0ubuntu3) ... Processing triggers for ca-certificates (20211016) ... Updating certificates in /etc/ssl/certs... 0 added, 0 removed; done. Running hooks in /etc/ca-certificates/update.d... done. RUN: /usr/share/launchpad-buildd/bin/sbuild-package PACKAGEBUILD-22293620 armhf jammy-proposed -c chroot:build-PACKAGEBUILD-22293620 --arch=armhf --dist=jammy-proposed --nolog fasta3_36.3.8h.2020-02-11-4.dsc Initiating build PACKAGEBUILD-22293620 with 4 jobs across 4 processor cores. Kernel reported to sbuild: 4.15.0-159-generic #167-Ubuntu SMP Mon Sep 20 23:06:52 UTC 2021 armv7l sbuild (Debian sbuild) 0.75.0 (21 Mar 2018) on bos02-arm64-054.buildd +==============================================================================+ | fasta3 36.3.8h.2020-02-11-4 (armhf) Tue, 19 Oct 2021 22:40:27 +0000 | +==============================================================================+ Package: fasta3 Version: 36.3.8h.2020-02-11-4 Source Version: 36.3.8h.2020-02-11-4 Distribution: jammy-proposed Machine Architecture: arm64 Host Architecture: armhf Build Architecture: armhf Build Type: any I: NOTICE: Log filtering will replace 'home/buildd/build-PACKAGEBUILD-22293620/chroot-autobuild' with '<>' +------------------------------------------------------------------------------+ | Fetch source files | +------------------------------------------------------------------------------+ Local sources ------------- fasta3_36.3.8h.2020-02-11-4.dsc exists in .; copying to chroot I: NOTICE: Log filtering will replace 'build/fasta3-QzZidI/fasta3-36.3.8h.2020-02-11' with '<>' I: NOTICE: Log filtering will replace 'build/fasta3-QzZidI' with '<>' +------------------------------------------------------------------------------+ | Install build-essential | +------------------------------------------------------------------------------+ Setup apt archive ----------------- Merged Build-Depends: build-essential, fakeroot Filtered Build-Depends: build-essential, fakeroot dpkg-deb: building package 'sbuild-build-depends-core-dummy' in '/<>/resolver-f9A10B/apt_archive/sbuild-build-depends-core-dummy.deb'. dpkg-scanpackages: warning: Packages in archive but missing from override file: dpkg-scanpackages: warning: sbuild-build-depends-core-dummy dpkg-scanpackages: info: Wrote 1 entries to output Packages file. Ign:1 copy:/<>/resolver-f9A10B/apt_archive ./ InRelease Get:2 copy:/<>/resolver-f9A10B/apt_archive ./ Release [957 B] Ign:3 copy:/<>/resolver-f9A10B/apt_archive ./ Release.gpg Get:4 copy:/<>/resolver-f9A10B/apt_archive ./ Sources [349 B] Get:5 copy:/<>/resolver-f9A10B/apt_archive ./ Packages [431 B] Fetched 1737 B in 0s (50.2 kB/s) Reading package lists... Reading package lists... Install core build dependencies (apt-based resolver) ---------------------------------------------------- Installing build dependencies Reading package lists... Building dependency tree... Reading state information... The following NEW packages will be installed: sbuild-build-depends-core-dummy 0 upgraded, 1 newly installed, 0 to remove and 0 not upgraded. Need to get 656 B of archives. After this operation, 0 B of additional disk space will be used. Get:1 copy:/<>/resolver-f9A10B/apt_archive ./ sbuild-build-depends-core-dummy 0.invalid.0 [656 B] debconf: delaying package configuration, since apt-utils is not installed Fetched 656 B in 0s (29.1 kB/s) Selecting previously unselected package sbuild-build-depends-core-dummy. (Reading database ... 12987 files and directories currently installed.) Preparing to unpack .../sbuild-build-depends-core-dummy_0.invalid.0_armhf.deb ... Unpacking sbuild-build-depends-core-dummy (0.invalid.0) ... Setting up sbuild-build-depends-core-dummy (0.invalid.0) ... +------------------------------------------------------------------------------+ | Check architectures | +------------------------------------------------------------------------------+ Arch check ok (armhf included in any all) +------------------------------------------------------------------------------+ | Install package build dependencies | +------------------------------------------------------------------------------+ Setup apt archive ----------------- Merged Build-Depends: debhelper-compat (= 13), libsimde-dev Filtered Build-Depends: debhelper-compat (= 13), libsimde-dev dpkg-deb: building package 'sbuild-build-depends-fasta3-dummy' in '/<>/resolver-f9A10B/apt_archive/sbuild-build-depends-fasta3-dummy.deb'. dpkg-scanpackages: warning: Packages in archive but missing from override file: dpkg-scanpackages: warning: sbuild-build-depends-core-dummy sbuild-build-depends-fasta3-dummy dpkg-scanpackages: info: Wrote 2 entries to output Packages file. Ign:1 copy:/<>/resolver-f9A10B/apt_archive ./ InRelease Get:2 copy:/<>/resolver-f9A10B/apt_archive ./ Release [963 B] Ign:3 copy:/<>/resolver-f9A10B/apt_archive ./ Release.gpg Get:4 copy:/<>/resolver-f9A10B/apt_archive ./ Sources [498 B] Get:5 copy:/<>/resolver-f9A10B/apt_archive ./ Packages [576 B] Fetched 2037 B in 0s (53.9 kB/s) Reading package lists... Reading package lists... Install fasta3 build dependencies (apt-based resolver) ------------------------------------------------------ Installing build dependencies Reading package lists... Building dependency tree... Reading state information... The following additional packages will be installed: autoconf automake autopoint autotools-dev bsdextrautils debhelper debugedit dh-autoreconf dh-strip-nondeterminism dwz file gettext gettext-base groff-base intltool-debian libarchive-zip-perl libdebhelper-perl libdw1 libelf1 libfile-stripnondeterminism-perl libicu67 libmagic-mgc libmagic1 libpipeline1 libsigsegv2 libsimde-dev libsub-override-perl libtool libuchardet0 libxml2 m4 man-db po-debconf Suggested packages: autoconf-archive gnu-standards autoconf-doc dh-make gettext-doc libasprintf-dev libgettextpo-dev groff libtool-doc gfortran | fortran95-compiler gcj-jdk m4-doc apparmor less www-browser libmail-box-perl Recommended packages: curl | wget | lynx libarchive-cpio-perl libltdl-dev libmail-sendmail-perl The following NEW packages will be installed: autoconf automake autopoint autotools-dev bsdextrautils debhelper debugedit dh-autoreconf dh-strip-nondeterminism dwz file gettext gettext-base groff-base intltool-debian libarchive-zip-perl libdebhelper-perl libdw1 libelf1 libfile-stripnondeterminism-perl libicu67 libmagic-mgc libmagic1 libpipeline1 libsigsegv2 libsimde-dev libsub-override-perl libtool libuchardet0 libxml2 m4 man-db po-debconf sbuild-build-depends-fasta3-dummy 0 upgraded, 34 newly installed, 0 to remove and 0 not upgraded. Need to get 17.5 MB of archives. After this operation, 62.8 MB of additional disk space will be used. Get:1 copy:/<>/resolver-f9A10B/apt_archive ./ sbuild-build-depends-fasta3-dummy 0.invalid.0 [676 B] Get:2 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf bsdextrautils armhf 2.36.1-8ubuntu2 [80.2 kB] Get:3 http://ftpmaster.internal/ubuntu jammy/main armhf libuchardet0 armhf 0.0.7-1build1 [75.6 kB] Get:4 http://ftpmaster.internal/ubuntu jammy/main armhf groff-base armhf 1.22.4-7 [870 kB] Get:5 http://ftpmaster.internal/ubuntu jammy/main armhf libpipeline1 armhf 1.5.3-1build1 [25.0 kB] Get:6 http://ftpmaster.internal/ubuntu jammy/main armhf man-db armhf 2.9.4-2build1 [1143 kB] Get:7 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libelf1 armhf 0.185-2 [43.1 kB] Get:8 http://ftpmaster.internal/ubuntu jammy/main armhf libicu67 armhf 67.1-7ubuntu1 [9788 kB] Get:9 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libxml2 armhf 2.9.12+dfsg-5 [598 kB] Get:10 http://ftpmaster.internal/ubuntu jammy/main armhf libmagic-mgc armhf 1:5.39-3build1 [236 kB] Get:11 http://ftpmaster.internal/ubuntu jammy/main armhf libmagic1 armhf 1:5.39-3build1 [80.4 kB] Get:12 http://ftpmaster.internal/ubuntu jammy/main armhf file armhf 1:5.39-3build1 [23.6 kB] Get:13 http://ftpmaster.internal/ubuntu jammy/main armhf gettext-base armhf 0.21-4ubuntu3 [36.0 kB] Get:14 http://ftpmaster.internal/ubuntu jammy/main armhf libsigsegv2 armhf 2.13-1ubuntu2 [13.7 kB] Get:15 http://ftpmaster.internal/ubuntu jammy/main armhf m4 armhf 1.4.18-5ubuntu1 [192 kB] Get:16 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf autoconf all 2.71-2 [338 kB] Get:17 http://ftpmaster.internal/ubuntu jammy/main armhf autotools-dev all 20180224.1+nmu1 [39.4 kB] Get:18 http://ftpmaster.internal/ubuntu jammy/main armhf automake all 1:1.16.4-2 [557 kB] Get:19 http://ftpmaster.internal/ubuntu jammy/main armhf autopoint all 0.21-4ubuntu3 [422 kB] Get:20 http://ftpmaster.internal/ubuntu jammy/main armhf libdebhelper-perl all 13.3.4ubuntu2 [62.5 kB] Get:21 http://ftpmaster.internal/ubuntu jammy/main armhf libtool all 2.4.6-15build1 [164 kB] Get:22 http://ftpmaster.internal/ubuntu jammy/main armhf dh-autoreconf all 20 [16.1 kB] Get:23 http://ftpmaster.internal/ubuntu jammy/main armhf libarchive-zip-perl all 1.68-1 [90.2 kB] Get:24 http://ftpmaster.internal/ubuntu jammy/main armhf libsub-override-perl all 0.09-2 [9532 B] Get:25 http://ftpmaster.internal/ubuntu jammy/main armhf libfile-stripnondeterminism-perl all 1.12.0-1 [17.5 kB] Get:26 http://ftpmaster.internal/ubuntu jammy/main armhf dh-strip-nondeterminism all 1.12.0-1 [5228 B] Get:27 http://ftpmaster.internal/ubuntu jammy-proposed/main armhf libdw1 armhf 0.185-2 [225 kB] Get:28 http://ftpmaster.internal/ubuntu jammy/main armhf debugedit armhf 1:5.0-0ubuntu2 [43.9 kB] Get:29 http://ftpmaster.internal/ubuntu jammy/main armhf dwz armhf 0.14-1build1 [99.2 kB] Get:30 http://ftpmaster.internal/ubuntu jammy/main armhf gettext armhf 0.21-4ubuntu3 [755 kB] Get:31 http://ftpmaster.internal/ubuntu jammy/main armhf intltool-debian all 0.35.0+20060710.5 [24.9 kB] Get:32 http://ftpmaster.internal/ubuntu jammy/main armhf po-debconf all 1.0.21+nmu1 [233 kB] Get:33 http://ftpmaster.internal/ubuntu jammy/main armhf debhelper all 13.3.4ubuntu2 [921 kB] Get:34 http://ftpmaster.internal/ubuntu jammy/universe armhf libsimde-dev all 0.7.2-4 [258 kB] debconf: delaying package configuration, since apt-utils is not installed Fetched 17.5 MB in 1s (13.0 MB/s) Selecting previously unselected package bsdextrautils. (Reading database ... 12987 files and directories currently installed.) Preparing to unpack .../00-bsdextrautils_2.36.1-8ubuntu2_armhf.deb ... Unpacking bsdextrautils (2.36.1-8ubuntu2) ... Selecting previously unselected package libuchardet0:armhf. Preparing to unpack .../01-libuchardet0_0.0.7-1build1_armhf.deb ... Unpacking libuchardet0:armhf (0.0.7-1build1) ... Selecting previously unselected package groff-base. Preparing to unpack .../02-groff-base_1.22.4-7_armhf.deb ... Unpacking groff-base (1.22.4-7) ... Selecting previously unselected package libpipeline1:armhf. Preparing to unpack .../03-libpipeline1_1.5.3-1build1_armhf.deb ... Unpacking libpipeline1:armhf (1.5.3-1build1) ... Selecting previously unselected package man-db. Preparing to unpack .../04-man-db_2.9.4-2build1_armhf.deb ... Unpacking man-db (2.9.4-2build1) ... Selecting previously unselected package libelf1:armhf. Preparing to unpack .../05-libelf1_0.185-2_armhf.deb ... Unpacking libelf1:armhf (0.185-2) ... Selecting previously unselected package libicu67:armhf. Preparing to unpack .../06-libicu67_67.1-7ubuntu1_armhf.deb ... Unpacking libicu67:armhf (67.1-7ubuntu1) ... Selecting previously unselected package libxml2:armhf. Preparing to unpack .../07-libxml2_2.9.12+dfsg-5_armhf.deb ... Unpacking libxml2:armhf (2.9.12+dfsg-5) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../08-libmagic-mgc_1%3a5.39-3build1_armhf.deb ... Unpacking libmagic-mgc (1:5.39-3build1) ... Selecting previously unselected package libmagic1:armhf. Preparing to unpack .../09-libmagic1_1%3a5.39-3build1_armhf.deb ... Unpacking libmagic1:armhf (1:5.39-3build1) ... Selecting previously unselected package file. Preparing to unpack .../10-file_1%3a5.39-3build1_armhf.deb ... Unpacking file (1:5.39-3build1) ... Selecting previously unselected package gettext-base. Preparing to unpack .../11-gettext-base_0.21-4ubuntu3_armhf.deb ... Unpacking gettext-base (0.21-4ubuntu3) ... Selecting previously unselected package libsigsegv2:armhf. Preparing to unpack .../12-libsigsegv2_2.13-1ubuntu2_armhf.deb ... Unpacking libsigsegv2:armhf (2.13-1ubuntu2) ... Selecting previously unselected package m4. Preparing to unpack .../13-m4_1.4.18-5ubuntu1_armhf.deb ... Unpacking m4 (1.4.18-5ubuntu1) ... Selecting previously unselected package autoconf. Preparing to unpack .../14-autoconf_2.71-2_all.deb ... Unpacking autoconf (2.71-2) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../15-autotools-dev_20180224.1+nmu1_all.deb ... Unpacking autotools-dev (20180224.1+nmu1) ... Selecting previously unselected package automake. Preparing to unpack .../16-automake_1%3a1.16.4-2_all.deb ... Unpacking automake (1:1.16.4-2) ... Selecting previously unselected package autopoint. Preparing to unpack .../17-autopoint_0.21-4ubuntu3_all.deb ... Unpacking autopoint (0.21-4ubuntu3) ... Selecting previously unselected package libdebhelper-perl. Preparing to unpack .../18-libdebhelper-perl_13.3.4ubuntu2_all.deb ... Unpacking libdebhelper-perl (13.3.4ubuntu2) ... Selecting previously unselected package libtool. Preparing to unpack .../19-libtool_2.4.6-15build1_all.deb ... Unpacking libtool (2.4.6-15build1) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../20-dh-autoreconf_20_all.deb ... Unpacking dh-autoreconf (20) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../21-libarchive-zip-perl_1.68-1_all.deb ... Unpacking libarchive-zip-perl (1.68-1) ... Selecting previously unselected package libsub-override-perl. Preparing to unpack .../22-libsub-override-perl_0.09-2_all.deb ... Unpacking libsub-override-perl (0.09-2) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../23-libfile-stripnondeterminism-perl_1.12.0-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (1.12.0-1) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../24-dh-strip-nondeterminism_1.12.0-1_all.deb ... Unpacking dh-strip-nondeterminism (1.12.0-1) ... Selecting previously unselected package libdw1:armhf. Preparing to unpack .../25-libdw1_0.185-2_armhf.deb ... Unpacking libdw1:armhf (0.185-2) ... Selecting previously unselected package debugedit. Preparing to unpack .../26-debugedit_1%3a5.0-0ubuntu2_armhf.deb ... Unpacking debugedit (1:5.0-0ubuntu2) ... Selecting previously unselected package dwz. Preparing to unpack .../27-dwz_0.14-1build1_armhf.deb ... Unpacking dwz (0.14-1build1) ... Selecting previously unselected package gettext. Preparing to unpack .../28-gettext_0.21-4ubuntu3_armhf.deb ... Unpacking gettext (0.21-4ubuntu3) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../29-intltool-debian_0.35.0+20060710.5_all.deb ... Unpacking intltool-debian (0.35.0+20060710.5) ... Selecting previously unselected package po-debconf. Preparing to unpack .../30-po-debconf_1.0.21+nmu1_all.deb ... Unpacking po-debconf (1.0.21+nmu1) ... Selecting previously unselected package debhelper. Preparing to unpack .../31-debhelper_13.3.4ubuntu2_all.deb ... Unpacking debhelper (13.3.4ubuntu2) ... Selecting previously unselected package libsimde-dev. Preparing to unpack .../32-libsimde-dev_0.7.2-4_all.deb ... Unpacking libsimde-dev (0.7.2-4) ... Selecting previously unselected package sbuild-build-depends-fasta3-dummy. Preparing to unpack .../33-sbuild-build-depends-fasta3-dummy_0.invalid.0_armhf.deb ... Unpacking sbuild-build-depends-fasta3-dummy (0.invalid.0) ... Setting up libpipeline1:armhf (1.5.3-1build1) ... Setting up libsimde-dev (0.7.2-4) ... Setting up bsdextrautils (2.36.1-8ubuntu2) ... update-alternatives: using /usr/bin/write.ul to provide /usr/bin/write (write) in auto mode Setting up libicu67:armhf (67.1-7ubuntu1) ... Setting up libmagic-mgc (1:5.39-3build1) ... Setting up libarchive-zip-perl (1.68-1) ... Setting up libdebhelper-perl (13.3.4ubuntu2) ... Setting up libmagic1:armhf (1:5.39-3build1) ... Setting up gettext-base (0.21-4ubuntu3) ... Setting up file (1:5.39-3build1) ... Setting up autotools-dev (20180224.1+nmu1) ... Setting up libsigsegv2:armhf (2.13-1ubuntu2) ... Setting up autopoint (0.21-4ubuntu3) ... Setting up libuchardet0:armhf (0.0.7-1build1) ... Setting up libsub-override-perl (0.09-2) ... Setting up libelf1:armhf (0.185-2) ... Setting up libxml2:armhf (2.9.12+dfsg-5) ... Setting up libfile-stripnondeterminism-perl (1.12.0-1) ... Setting up libdw1:armhf (0.185-2) ... Setting up gettext (0.21-4ubuntu3) ... Setting up libtool (2.4.6-15build1) ... Setting up m4 (1.4.18-5ubuntu1) ... Setting up intltool-debian (0.35.0+20060710.5) ... Setting up autoconf (2.71-2) ... Setting up dh-strip-nondeterminism (1.12.0-1) ... Setting up dwz (0.14-1build1) ... Setting up groff-base (1.22.4-7) ... Setting up debugedit (1:5.0-0ubuntu2) ... Setting up automake (1:1.16.4-2) ... update-alternatives: using /usr/bin/automake-1.16 to provide /usr/bin/automake (automake) in auto mode Setting up po-debconf (1.0.21+nmu1) ... Setting up man-db (2.9.4-2build1) ... Not building database; man-db/auto-update is not 'true'. Created symlink /etc/systemd/system/timers.target.wants/man-db.timer → /lib/systemd/system/man-db.timer. Setting up dh-autoreconf (20) ... Setting up debhelper (13.3.4ubuntu2) ... Setting up sbuild-build-depends-fasta3-dummy (0.invalid.0) ... Processing triggers for libc-bin (2.34-0ubuntu3) ... +------------------------------------------------------------------------------+ | Build environment | +------------------------------------------------------------------------------+ Kernel: Linux 4.15.0-159-generic arm64 (armv7l) Toolchain package versions: binutils_2.37-7ubuntu1 dpkg-dev_1.20.9ubuntu2 g++-11_11.2.0-7ubuntu2 gcc-11_11.2.0-7ubuntu2 libc6-dev_2.34-0ubuntu3 libstdc++-11-dev_11.2.0-7ubuntu2 libstdc++6_11.2.0-7ubuntu2 linux-libc-dev_5.13.0-19.19 Package versions: adduser_3.118ubuntu5 advancecomp_2.1-2.1ubuntu1 apt_2.3.10 autoconf_2.71-2 automake_1:1.16.4-2 autopoint_0.21-4ubuntu3 autotools-dev_20180224.1+nmu1 base-files_12ubuntu1 base-passwd_3.5.52 bash_5.1-3ubuntu2 binutils_2.37-7ubuntu1 binutils-arm-linux-gnueabihf_2.37-7ubuntu1 binutils-common_2.37-7ubuntu1 bsdextrautils_2.36.1-8ubuntu2 bsdutils_1:2.36.1-8ubuntu2 build-essential_12.9ubuntu2 bzip2_1.0.8-4ubuntu4 ca-certificates_20211016 coreutils_8.32-4ubuntu3 cpp_4:11.2.0-1ubuntu1 cpp-11_11.2.0-7ubuntu2 dash_0.5.11+git20210120+802ebd4-1build1 debconf_1.5.77 debhelper_13.3.4ubuntu2 debianutils_5.5-1 debugedit_1:5.0-0ubuntu2 dh-autoreconf_20 dh-strip-nondeterminism_1.12.0-1 diffutils_1:3.8-0ubuntu1 dpkg_1.20.9ubuntu2 dpkg-dev_1.20.9ubuntu2 dwz_0.14-1build1 e2fsprogs_1.46.3-1ubuntu3 fakeroot_1.25.3-1.1ubuntu3 file_1:5.39-3build1 findutils_4.8.0-1ubuntu2 g++_4:11.2.0-1ubuntu1 g++-11_11.2.0-7ubuntu2 gcc_4:11.2.0-1ubuntu1 gcc-11_11.2.0-7ubuntu2 gcc-11-base_11.2.0-7ubuntu2 gettext_0.21-4ubuntu3 gettext-base_0.21-4ubuntu3 gpg_2.2.20-1ubuntu4 gpg-agent_2.2.20-1ubuntu4 gpgconf_2.2.20-1ubuntu4 gpgv_2.2.20-1ubuntu4 grep_3.7-0ubuntu1 groff-base_1.22.4-7 gzip_1.10-4ubuntu2 hostname_3.23ubuntu1 init_1.60build1 init-system-helpers_1.60build1 intltool-debian_0.35.0+20060710.5 libacl1_2.2.53-10ubuntu2 libapparmor1_3.0.3-0ubuntu2 libapt-pkg6.0_2.3.10 libarchive-zip-perl_1.68-1 libargon2-1_0~20171227-0.2build22 libasan6_11.2.0-7ubuntu2 libassuan0_2.5.5-1 libatomic1_11.2.0-7ubuntu2 libattr1_1:2.5.1-1 libaudit-common_1:3.0-2ubuntu3 libaudit1_1:3.0-2ubuntu3 libbinutils_2.37-7ubuntu1 libblkid1_2.36.1-8ubuntu2 libbz2-1.0_1.0.8-4ubuntu4 libc-bin_2.34-0ubuntu3 libc-dev-bin_2.34-0ubuntu3 libc6_2.34-0ubuntu3 libc6-dev_2.34-0ubuntu3 libcap-ng0_0.7.9-2.2build2 libcap2_1:2.44-1build2 libcc1-0_11.2.0-7ubuntu2 libcom-err2_1.46.3-1ubuntu3 libcrypt-dev_1:4.4.18-4ubuntu2 libcrypt1_1:4.4.18-4ubuntu2 libcryptsetup12_2:2.3.6-0ubuntu1 libctf-nobfd0_2.37-7ubuntu1 libctf0_2.37-7ubuntu1 libdb5.3_5.3.28+dfsg1-0.8ubuntu2 libdebconfclient0_0.256ubuntu4 libdebhelper-perl_13.3.4ubuntu2 libdevmapper1.02.1_2:1.02.175-2.1ubuntu3 libdpkg-perl_1.20.9ubuntu2 libdw1_0.185-2 libelf1_0.185-2 libext2fs2_1.46.3-1ubuntu3 libfakeroot_1.25.3-1.1ubuntu3 libffi8_3.4.2-1ubuntu5 libfile-stripnondeterminism-perl_1.12.0-1 libgcc-11-dev_11.2.0-7ubuntu2 libgcc-s1_11.2.0-7ubuntu2 libgcrypt20_1.8.7-5ubuntu2 libgdbm-compat4_1.21-1 libgdbm6_1.21-1 libgmp10_2:6.2.1+dfsg-1ubuntu3 libgnutls30_3.7.1-5ubuntu1 libgomp1_11.2.0-7ubuntu2 libgpg-error0_1.42-3 libgssapi-krb5-2_1.18.3-7 libhogweed6_3.7.3-1build1 libicu67_67.1-7ubuntu1 libidn2-0_2.3.2-2 libip4tc2_1.8.7-1ubuntu3 libisl23_0.24-2 libjson-c5_0.15-2build3 libk5crypto3_1.18.3-7 libkeyutils1_1.6.1-2ubuntu2 libkmod2_28-1ubuntu4 libkrb5-3_1.18.3-7 libkrb5support0_1.18.3-7 liblockfile-bin_1.17-1build1 liblockfile1_1.17-1build1 liblz4-1_1.9.3-2build1 liblzma5_5.2.5-2build1 libmagic-mgc_1:5.39-3build1 libmagic1_1:5.39-3build1 libmount1_2.36.1-8ubuntu2 libmpc3_1.2.1-1 libmpfr6_4.1.0-3build2 libncurses6_6.2+20210905-1 libncursesw6_6.2+20210905-1 libnettle8_3.7.3-1build1 libnpth0_1.6-3build1 libnsl-dev_1.3.0-2build1 libnsl2_1.3.0-2build1 libp11-kit0_0.24.0-5 libpam-modules_1.3.1-5ubuntu11 libpam-modules-bin_1.3.1-5ubuntu11 libpam-runtime_1.3.1-5ubuntu11 libpam0g_1.3.1-5ubuntu11 libpcre2-8-0_10.37-0ubuntu2 libpcre3_2:8.39-13build4 libperl5.32_5.32.1-3ubuntu3 libpipeline1_1.5.3-1build1 libpng16-16_1.6.37-3build4 libprocps8_2:3.3.17-5ubuntu3 libreadline8_8.1-2build1 libseccomp2_2.5.1-1ubuntu2 libselinux1_3.1-3build3 libsemanage-common_3.1-1ubuntu3 libsemanage1_3.1-1ubuntu3 libsepol1_3.1-1ubuntu2 libsigsegv2_2.13-1ubuntu2 libsimde-dev_0.7.2-4 libsmartcols1_2.36.1-8ubuntu2 libsqlite3-0_3.36.0-2 libss2_1.46.3-1ubuntu3 libssl1.1_1.1.1l-1ubuntu1 libstdc++-11-dev_11.2.0-7ubuntu2 libstdc++6_11.2.0-7ubuntu2 libsub-override-perl_0.09-2 libsystemd0_248.3-1ubuntu8 libtasn1-6_4.17.0-2 libtinfo6_6.2+20210905-1 libtirpc-common_1.3.2-2 libtirpc-dev_1.3.2-2 libtirpc3_1.3.2-2 libtool_2.4.6-15build1 libubsan1_11.2.0-7ubuntu2 libuchardet0_0.0.7-1build1 libudev1_248.3-1ubuntu8 libunistring2_0.9.10-6 libuuid1_2.36.1-8ubuntu2 libxml2_2.9.12+dfsg-5 libxxhash0_0.8.0-2build1 libzstd1_1.4.8+dfsg-3 linux-libc-dev_5.13.0-19.19 lockfile-progs_0.1.19 login_1:4.8.1-1ubuntu9 logsave_1.46.3-1ubuntu3 lsb-base_11.1.0ubuntu3 lto-disabled-list_16 m4_1.4.18-5ubuntu1 make_4.3-4ubuntu2 man-db_2.9.4-2build1 mawk_1.3.4.20200120-2build1 mount_2.36.1-8ubuntu2 ncurses-base_6.2+20210905-1 ncurses-bin_6.2+20210905-1 openssl_1.1.1l-1ubuntu1 optipng_0.7.7-2 passwd_1:4.8.1-1ubuntu9 patch_2.7.6-7build1 perl_5.32.1-3ubuntu3 perl-base_5.32.1-3ubuntu3 perl-modules-5.32_5.32.1-3ubuntu3 pinentry-curses_1.1.1-1build1 pkgbinarymangler_148 po-debconf_1.0.21+nmu1 policyrcd-script-zg2_0.1-3 procps_2:3.3.17-5ubuntu3 readline-common_8.1-2build1 rpcsvc-proto_1.4.2-0ubuntu5 sbuild-build-depends-core-dummy_0.invalid.0 sbuild-build-depends-fasta3-dummy_0.invalid.0 sed_4.7-1ubuntu2 sensible-utils_0.0.17 systemd_248.3-1ubuntu8 systemd-sysv_248.3-1ubuntu8 systemd-timesyncd_248.3-1ubuntu8 sysvinit-utils_2.96-7ubuntu2 tar_1.34+dfsg-1build2 tzdata_2021a-2ubuntu1 ubuntu-keyring_2021.03.26 usrmerge_25ubuntu1 util-linux_2.36.1-8ubuntu2 xz-utils_5.2.5-2build1 zlib1g_1:1.2.11.dfsg-2ubuntu7 +------------------------------------------------------------------------------+ | Build | +------------------------------------------------------------------------------+ Unpack source ------------- gpgv: Signature made Thu Sep 9 07:45:51 2021 UTC gpgv: using RSA key F1F007320A035541F0A663CA578A0494D1C646D1 gpgv: issuer "tille@debian.org" gpgv: Can't check signature: No public key dpkg-source: warning: failed to verify signature on ./fasta3_36.3.8h.2020-02-11-4.dsc dpkg-source: info: extracting fasta3 in /<> dpkg-source: info: unpacking fasta3_36.3.8h.2020-02-11.orig.tar.gz dpkg-source: info: unpacking fasta3_36.3.8h.2020-02-11-4.debian.tar.xz dpkg-source: info: using patch list from debian/patches/series dpkg-source: info: applying Makefile.patch dpkg-source: info: applying simde dpkg-source: info: applying local_tests dpkg-source: info: applying adjust-scripts Check disk space ---------------- Sufficient free space for build User Environment ---------------- APT_CONFIG=/var/lib/sbuild/apt.conf DEB_BUILD_OPTIONS=parallel=4 HOME=/sbuild-nonexistent LANG=C.UTF-8 LC_ALL=C.UTF-8 LOGNAME=buildd PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games SCHROOT_ALIAS_NAME=build-PACKAGEBUILD-22293620 SCHROOT_CHROOT_NAME=build-PACKAGEBUILD-22293620 SCHROOT_COMMAND=env SCHROOT_GID=2501 SCHROOT_GROUP=buildd SCHROOT_SESSION_ID=build-PACKAGEBUILD-22293620 SCHROOT_UID=2001 SCHROOT_USER=buildd SHELL=/bin/sh TERM=unknown USER=buildd V=1 dpkg-buildpackage ----------------- dpkg-buildpackage: info: source package fasta3 dpkg-buildpackage: info: source version 36.3.8h.2020-02-11-4 dpkg-buildpackage: info: source distribution unstable dpkg-source --before-build . dpkg-buildpackage: info: host architecture armhf debian/rules clean dh clean --sourcedirectory src debian/rules override_dh_auto_clean make[1]: Entering directory '/<>' if [ -d src ]; then cd src && /usr/bin/make -f "../make/Makefile.linux64" clean-up; fi make[2]: Entering directory '/<>/src' rm -f *.o fasta36 ssearch36 lalign36 fasts36 fastx36 tfastx36 fasty36 tfasty36 tfasts36 fastm36 tfastm36 fastf36 tfastf36 glsearch36 ggsearch36 map_db; rm -rf ../bin/* make[2]: Leaving directory '/<>/src' make[1]: Leaving directory '/<>' dh_autoreconf_clean -O--sourcedirectory=src dh_clean -O--sourcedirectory=src debian/rules binary-arch dh binary-arch --sourcedirectory src dh_update_autotools_config -a -O--sourcedirectory=src dh_autoreconf -a -O--sourcedirectory=src dh_auto_configure -a -O--sourcedirectory=src debian/rules override_dh_auto_build make[1]: Entering directory '/<>' dh_auto_build --sourcedirectory make --builddirectory src --buildsystem makefile -- -f "../make/Makefile.linux64" cd src && make -j4 "INSTALL=install --strip-program=true" -f ../make/Makefile.linux64 make[2]: Entering directory '/<>/src' cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_THR -DCOMP_MLIB -c comp_lib9.c -o comp_mthr9.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c work_thr2.c cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c pthr_subs2.c cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_THR -DCOMP_MLIB -c compacc2e.c -o compacc2_t.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c mshowbest.c -o showbest.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c build_ares.c -o build_ares.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c re_getlib.c cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_THR -c mshowalign2.c -o mshowalign2_t.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c htime.c mshowalign2.c: In function ‘showalign’: mshowalign2.c:614:64: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=] 614 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n", | ~~^ | | | long unsigned int | %u 615 | nc,maxc,strlen(seqc0),strlen(seqc1)); | ~~~~~~~~~~~~~ | | | size_t {aka unsigned int} mshowalign2.c:614:68: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 6 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=] 614 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n", | ~~^ | | | long unsigned int | %u 615 | nc,maxc,strlen(seqc0),strlen(seqc1)); | ~~~~~~~~~~~~~ | | | size_t {aka unsigned int} cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c apam.c cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c doinit.c cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTA initfa.c -o init_fa.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DLOCAL_SCORE -c scaleswn.c -o scale_se.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c karlin.c scaleswn.c: In function ‘process_hist’: scaleswn.c:255:55: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 255 | fprintf(stderr," cannot allocate pstat_union: %ld\n",sizeof(struct pstat_str)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~ | | | | | unsigned int | long int | %d initfa.c: In function ‘alloc_pam2p’: initfa.c:2001:46: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2001 | "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropnfa.c -o drop_nfa.o dropnfa.c: In function ‘init_work’: dropnfa.c:306:77: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=] 306 | fprintf (stderr,"*** error [%s:%d] - cannot allocate diagonal arrays: %lu\n", | ~~^ | | | long unsigned int | %u cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -Wdate-time -D_FORTIFY_SOURCE=2 -c -o wm_align.o wm_align.c cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTA -c cal_cons2.c -o calcons_fa.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c nmgetlib.c -o lgetlib.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c mmgetaa.c -o lgetaa_m.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c c_dispn.c nmgetlib.c: In function ‘open_lib’: nmgetlib.c:403:59: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 403 | fprintf(stderr,"\n *** cannot allocate lmf_str (%ld) for %s\n", | ~~^ | | | long int | %d 404 | sizeof(struct lmf_str),lib_p->file_name); | ~~~~~~~~~~~~~~~~~~~~~~ | | | unsigned int nmgetlib.c: In function ‘sel_hacc_libstr_init’: nmgetlib.c:2026:49: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2026 | fprintf(stderr, "cannot allocate acc_hash[%ld]\n",hash_max*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d nmgetlib.c:2032:54: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2032 | fprintf(stderr, "cannot allocate acc_hash_link[%ld]\n",acc_cnt*sizeof(char *)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d nmgetlib.c: In function ‘sel_hacc_gi_init’: nmgetlib.c:2154:48: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2154 | fprintf(stderr, "cannot allocate gi_hash[%ld]\n",hash_max*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d nmgetlib.c:2160:53: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2160 | fprintf(stderr, "cannot allocate gi_hash_link[%ld]\n",acc_cnt*sizeof(char *)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d nmgetlib.c: In function ‘agetlib’: nmgetlib.c:621:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 621 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:623:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 623 | fgets(&lm_fd->lline[MAX_STR/2],MAX_STR/2,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:667:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 667 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:682:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 682 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘aranlib’: nmgetlib.c:702:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 702 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘qgetlib’: nmgetlib.c:766:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 766 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:768:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 768 | fgets(&lm_fd->lline[MAX_STR/2],MAX_STR/2,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:800:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 800 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘qranlib’: nmgetlib.c:823:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 823 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘lgetlib’: nmgetlib.c:878:7: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 878 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:916:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 916 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘lget_ann’: nmgetlib.c:940:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 940 | fgets(desc,sizeof(desc),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:942:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 942 | fgets(desc,sizeof(desc),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:946:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 946 | fgets(acc,sizeof(acc),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:948:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 948 | fgets(acc,sizeof(acc),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:956:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 956 | fgets(ver,sizeof(ver),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:958:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 958 | fgets(ver,sizeof(ver),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘lranlib’: nmgetlib.c:1032:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1032 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1039:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1039 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘pgetlib’: nmgetlib.c:1078:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1078 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); /* get the extra line */ | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1100:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1100 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘pranlib’: nmgetlib.c:1124:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1124 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1128:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1128 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1130:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1130 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1136:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1136 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘egetlib’: nmgetlib.c:1220:1: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1220 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘eranlib’: nmgetlib.c:1250:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1250 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1255:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1255 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1258:56: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1258 | while (lm_fd->lline[0]!='D' || lm_fd->lline[1]!='E') fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1265:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1265 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘igetlib’: nmgetlib.c:1297:46: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1297 | while (lm_fd->lline[0]==';') fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1329:13: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1329 | fgets(lm_fd->lline,MAX_STR-strlen(lm_fd->lline),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1333:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1333 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘iranlib’: nmgetlib.c:1360:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1360 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1371:38: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1371 | while (lm_fd->lline[0]==';') fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1380:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1380 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘vgetlib’: nmgetlib.c:1419:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1419 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1459:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1459 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR-strlen(lm_fd->lline),lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1465:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1465 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘vranlib’: nmgetlib.c:1492:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1492 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1508:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1508 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1525:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1525 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘gcg_getlib’: nmgetlib.c:1567:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1567 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1570:9: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1570 | fgets(&lm_fd->lline[strlen(lm_fd->lline)],MAX_STR/2,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1572:7: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1572 | fgets(&lm_fd->lline[strlen(lm_fd->lline)-MAX_STR/2],MAX_STR/2,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1592:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1592 | fread((char *)seqp,(size_t)r_block,(size_t)1,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1607:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1607 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c: In function ‘gcg_ranlib’: nmgetlib.c:1631:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1631 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1641:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1641 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ nmgetlib.c:1672:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1672 | fgets(lm_fd->lline,MAX_STR,lm_fd->libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c ncbl2_mlib.c -o ncbl2_mlib.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c lib_sel.c ncbl2_mlib.c: In function ‘ncbl2_getlibn’: ncbl2_mlib.c:1433:61: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=] 1433 | " could not read sequence record: %s %lld %ld != %ld: %d\n", | ~~^ | | | long int | %d 1434 | libstr,*libpos,tmp,seqcnt,*seq); | ~~~ | | | size_t {aka unsigned int} ncbl2_mlib.c:1453:65: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 4 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=] 1453 | fprintf(stderr," could not read sequence record: %lld %ld/%ld\n", | ~~^ | | | long int | %d 1454 | *libpos,tmp,seqcnt); | ~~~ | | | size_t {aka unsigned int} ncbl2_mlib.c:1593:72: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘unsigned int’ [-Wformat=] 1593 | fprintf(stderr, "*** error [%s:%d] malloc amb table error size %ld\n", | ~~^ | | | long int | %d 1594 | __FILE__, __LINE__, amb_cnt * sizeof(unsigned int)); | ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | unsigned int ncbl2_mlib.c: In function ‘load_ncbl2’: ncbl2_mlib.c:810:5: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 810 | fread(title_str,(size_t)1,(size_t)title_len,ifile); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c:820:7: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 820 | fread(pdb_title_str,(size_t)1,(size_t)pdb_title_len,ifile); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c:831:5: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 831 | fread(date_str,(size_t)1,(size_t)date_len,ifile); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c: In function ‘ncbl2_ranlib’: ncbl2_mlib.c:1719:5: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1719 | fread(str,(size_t)1,(size_t)(llen),m_fd->hfile); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c:1734:5: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1734 | fread(my_buff,(size_t)1,llen,m_fd->hfile); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c: In function ‘src_int4_read’: ncbl2_mlib.c:1840:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1840 | fread((char *)&b[0],(size_t)1,(size_t)4,fd); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c: In function ‘src_long4_read’: ncbl2_mlib.c:1855:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1855 | fread((char *)&b[0],(size_t)1,(size_t)4,fd); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c: In function ‘src_uint4_read’: ncbl2_mlib.c:1868:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1868 | fread((char *)&b[0],(size_t)1,(size_t)4,fd); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c: In function ‘src_long8_read’: ncbl2_mlib.c:1883:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1883 | fread((char *)&b[0],(size_t)1,(size_t)8,fd); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c: In function ‘ncbi_long8_read’: ncbl2_mlib.c:1903:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1903 | fread((char *)&b[0],(size_t)1,(size_t)8,fd); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c: In function ‘src_char_read’: ncbl2_mlib.c:1910:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1910 | fread(val,(size_t)1,(size_t)1,fd); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ncbl2_mlib.c: In function ‘src_fstr_read’: ncbl2_mlib.c:1915:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 1915 | fread(val,(size_t)slen,(size_t)1,fd); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c url_subs.c cc -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -Wdate-time -D_FORTIFY_SOURCE=2 -c -o mrandom.o mrandom.c cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DSW_SSE2 -DSSEARCH initfa.c -o init_sw_sse.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c dropgsw2.c -o dropgsw2_sse.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c smith_waterman_sse2.c initfa.c: In function ‘alloc_pam2p’: initfa.c:2001:46: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2001 | "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c wm_align.c -o lwm_align.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSSEARCH -c cal_cons2.c -o calcons_sw.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c pssm_asn_subs.c cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_MLIB -c comp_lib9.c -o comp_mlib9.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DCOMP_MLIB -c compacc2e.c -o compacc2_s.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DLALIGN -c mshowalign2.c -o lshowalign.o mshowalign2.c: In function ‘showalign’: mshowalign2.c:614:64: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=] 614 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n", | ~~^ | | | long unsigned int | %u 615 | nc,maxc,strlen(seqc0),strlen(seqc1)); | ~~~~~~~~~~~~~ | | | size_t {aka unsigned int} mshowalign2.c:614:68: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 6 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=] 614 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n", | ~~^ | | | long unsigned int | %u 615 | nc,maxc,strlen(seqc0),strlen(seqc1)); | ~~~~~~~~~~~~~ | | | size_t {aka unsigned int} cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DLALIGN initfa.c -o init_lal.o initfa.c: In function ‘alloc_pam2p’: initfa.c:2001:46: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2001 | "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c last_thresh.c cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DLALIGN -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c dropgsw2.c -o droplal2_sse.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c lsim4.c lsim4.c: In function ‘ckalloc’: cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DLALIGN -DLCAL_CONS -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c cal_cons2.c -o calcons_la.o lsim4.c:994:47: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=] 994 | fprintf(stderr,"Ran out of near memory: %ld*%ld/%ld\n",amount,size,mtotal); | ~~^ ~~~~~~ | | | | long int size_t {aka unsigned int} | %d lsim4.c:994:51: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 4 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=] 994 | fprintf(stderr,"Ran out of near memory: %ld*%ld/%ld\n",amount,size,mtotal); | ~~^ ~~~~ | | | | long int size_t {aka unsigned int} | %d lsim4.c:994:55: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=] 994 | fprintf(stderr,"Ran out of near memory: %ld*%ld/%ld\n",amount,size,mtotal); | ~~^ ~~~~~~ | | | | long int size_t {aka unsigned int} | %d cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTS initfa.c -o init_fs.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c scaleswt.c -o scaleswts.o scaleswt.c: In function ‘process_hist’: scaleswt.c:184:52: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 184 | fprintf(stderr," cannot allocate rs_snion: %ld\n",sizeof(struct pstat_str)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~ | | | | | unsigned int | long int | %d scaleswt.c: In function ‘last_stats’: scaleswt.c:1230:48: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 1230 | fprintf(stderr," cannot allocate rs_s: %ld\n",sizeof(struct pstat_str)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~ | | | | | unsigned int | long int | %d cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c last_tat.c initfa.c: In function ‘alloc_pam2p’: initfa.c:2001:46: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2001 | "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTS tatstats.c -o tatstats_fs.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTS -c dropfs2.c -o drop_fs2.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTS -c cal_consf.c -o calcons_fs.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTX initfa.c -o init_fx.o dropfs2.c: In function ‘init_work’: dropfs2.c:377:61: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 377 | fprintf (stderr, " cannot allocate tatprobs array: %ld\n", | ~~^ | | | long int | %d 378 | tat_size * sizeof(struct tat_str *)); | ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | unsigned int initfa.c: In function ‘alloc_pam2p’: initfa.c:2001:46: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2001 | "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c faatran.c cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropfx2.c -o drop_fx.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTX -DTFAST initfa.c -o init_tfx.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DTFAST dropfx2.c -o drop_tfx.o dropfx2.c: In function ‘do_walign’: dropfx2.c:2660:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=] 2660 | fprintf(stderr,"*** error [%s:%d] - cannot allocate a_res [%lu]", | ~~^ | | | long unsigned int | %u 2661 | __FILE__, __LINE__, sizeof(struct a_res_str)); | ~~~~~~~~~~~~~~~~~~~~~~~~ | | | unsigned int dropfx2.c: In function ‘do_walign’: dropfx2.c:2660:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=] 2660 | fprintf(stderr,"*** error [%s:%d] - cannot allocate a_res [%lu]", | ~~^ | | | long unsigned int | %u 2661 | __FILE__, __LINE__, sizeof(struct a_res_str)); | ~~~~~~~~~~~~~~~~~~~~~~~~ | | | unsigned int initfa.c: In function ‘alloc_pam2p’: initfa.c:2001:46: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2001 | "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTY initfa.c -o init_fy.o initfa.c: In function ‘alloc_pam2p’: initfa.c:2001:46: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2001 | "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropfz3.c -o drop_fz.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTY -DTFAST initfa.c -o init_tfy.o dropfz3.c: In function ‘init_work’: dropfz3.c:629:79: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=] 629 | fprintf (stderr,"*** error [%s:%d] - cannot allocate diagonal arrays: %lu\n", | ~~^ | | | long unsigned int | %u dropfz3.c: In function ‘do_walign’: dropfz3.c:2672:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=] 2672 | fprintf(stderr,"*** error [%s:%d] - cannot allocate a_res [%lu]", | ~~^ | | | long unsigned int | %u 2673 | __FILE__, __LINE__, sizeof(struct a_res_str)); | ~~~~~~~~~~~~~~~~~~~~~~~~ | | | unsigned int cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DTFAST dropfz3.c -o drop_tfz.o initfa.c: In function ‘alloc_pam2p’: initfa.c:2001:46: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2001 | "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d dropfz3.c: In function ‘init_work’: dropfz3.c:629:79: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=] 629 | fprintf (stderr,"*** error [%s:%d] - cannot allocate diagonal arrays: %lu\n", | ~~^ | | | long unsigned int | %u dropfz3.c: In function ‘do_walign’: dropfz3.c:2672:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=] 2672 | fprintf(stderr,"*** error [%s:%d] - cannot allocate a_res [%lu]", | ~~^ | | | long unsigned int | %u 2673 | __FILE__, __LINE__, sizeof(struct a_res_str)); | ~~~~~~~~~~~~~~~~~~~~~~~~ | | | unsigned int cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTS -DTFAST initfa.c -o init_tfs.o initfa.c: In function ‘alloc_pam2p’: initfa.c:2001:46: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2001 | "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DTFAST -DFASTS dropfs2.c -o drop_tfs.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DTFAST -DFASTS -c cal_consf.c -o calcons_tfs.o dropfs2.c: In function ‘init_work’: dropfs2.c:377:61: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 377 | fprintf (stderr, " cannot allocate tatprobs array: %ld\n", | ~~^ | | | long int | %d 378 | tat_size * sizeof(struct tat_str *)); | ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | unsigned int cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTM initfa.c -o init_fm.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTM tatstats.c -o tatstats_fm.o initfa.c: In function ‘alloc_pam2p’: initfa.c:2001:46: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2001 | "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTM dropfs2.c -o drop_fm.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTM -c cal_consf.c -o calcons_fm.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c mshowalign2.c -o mshowalign2_s.o dropfs2.c: In function ‘init_work’: dropfs2.c:377:61: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 377 | fprintf (stderr, " cannot allocate tatprobs array: %ld\n", | ~~^ | | | long int | %d 378 | tat_size * sizeof(struct tat_str *)); | ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | unsigned int cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTM -DTFAST initfa.c -o init_tfm.o mshowalign2.c: In function ‘showalign’: mshowalign2.c:614:64: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=] 614 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n", | ~~^ | | | long unsigned int | %u 615 | nc,maxc,strlen(seqc0),strlen(seqc1)); | ~~~~~~~~~~~~~ | | | size_t {aka unsigned int} mshowalign2.c:614:68: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 6 has type ‘size_t’ {aka ‘unsigned int’} [-Wformat=] 614 | fprintf(stderr," mshowalign: nc/maxc: %d/%d seqc0/1: %lu/%lu\n", | ~~^ | | | long unsigned int | %u 615 | nc,maxc,strlen(seqc0),strlen(seqc1)); | ~~~~~~~~~~~~~ | | | size_t {aka unsigned int} cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DTFAST -DFASTM dropfs2.c -o drop_tfm.o initfa.c: In function ‘alloc_pam2p’: initfa.c:2001:46: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2001 | "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DTFAST -DFASTM -c cal_consf.c -o calcons_tfm.o dropfs2.c: In function ‘init_work’: dropfs2.c:377:61: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 377 | fprintf (stderr, " cannot allocate tatprobs array: %ld\n", | ~~^ | | | long int | %d 378 | tat_size * sizeof(struct tat_str *)); | ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ | | | unsigned int cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF initfa.c -o init_ff.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTF -c scaleswt.c -o scaleswtf.o scaleswt.c: In function ‘process_hist’: scaleswt.c:184:52: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 184 | fprintf(stderr," cannot allocate rs_snion: %ld\n",sizeof(struct pstat_str)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~ | | | | | unsigned int | long int | %d cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF tatstats.c -o tatstats_ff.o scaleswt.c: In function ‘last_stats’: scaleswt.c:1230:48: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 1230 | fprintf(stderr," cannot allocate rs_s: %ld\n",sizeof(struct pstat_str)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~ | | | | | unsigned int | long int | %d initfa.c: In function ‘alloc_pam2p’: initfa.c:2001:46: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2001 | "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF dropff2.c -o drop_ff2.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DFASTF -c cal_consf.c -o calcons_ff.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF -DTFAST initfa.c -o init_tf.o dropff2.c: In function ‘init_work’: dropff2.c:120:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=] 120 | fprintf(stderr, "*** error [%s:%d] - cannot calloc f_str [%lu]\n", | ~~^ | | | long unsigned int | %u 121 | __FILE__, __LINE__, sizeof(struct f_struct)); | ~~~~~~~~~~~~~~~~~~~~~~~ | | | unsigned int dropff2.c: In function ‘do_walign’: dropff2.c:1176:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=] 1176 | fprintf(stderr,"*** error [%s:%d] - cannot allocate a_res [%lu]", | ~~^ | | | long unsigned int | %u 1177 | __FILE__, __LINE__, sizeof(struct a_res_str)); | ~~~~~~~~~~~~~~~~~~~~~~~~ | | | unsigned int cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DFASTF -DTFAST dropff2.c -o drop_tff.o initfa.c: In function ‘alloc_pam2p’: initfa.c:2001:46: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2001 | "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d dropff2.c: In function ‘init_work’: dropff2.c:120:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=] 120 | fprintf(stderr, "*** error [%s:%d] - cannot calloc f_str [%lu]\n", | ~~^ | | | long unsigned int | %u 121 | __FILE__, __LINE__, sizeof(struct f_struct)); | ~~~~~~~~~~~~~~~~~~~~~~~ | | | unsigned int dropff2.c: In function ‘do_walign’: dropff2.c:1176:66: warning: format ‘%lu’ expects argument of type ‘long unsigned int’, but argument 5 has type ‘unsigned int’ [-Wformat=] 1176 | fprintf(stderr,"*** error [%s:%d] - cannot allocate a_res [%lu]", | ~~^ | | | long unsigned int | %u 1177 | __FILE__, __LINE__, sizeof(struct a_res_str)); | ~~~~~~~~~~~~~~~~~~~~~~~~ | | | unsigned int cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DTFAST -DFASTF -c cal_consf.c -o calcons_tff.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DNORMAL_DIST -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c scaleswn.c -o scale_sn.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DSW_SSE2 -DGLSEARCH initfa.c -o init_lnw_sse.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DSW_SSE2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropnnw2.c -o droplnw_sse.o scaleswn.c: In function ‘process_hist’: scaleswn.c:255:55: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 255 | fprintf(stderr," cannot allocate pstat_union: %ld\n",sizeof(struct pstat_str)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~~ | | | | | unsigned int | long int | %d initfa.c: In function ‘alloc_pam2p’: initfa.c:2001:46: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2001 | "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c glocal_sse2.c cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DGGSEARCH -c wm_align.c -o gwm_align.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c -DSW_SSE2 -DGGSEARCH initfa.c -o init_gnw_sse.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -DGLOBAL_GLOBAL -DSW_SSE2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -c dropnnw2.c -o dropgnw_sse.o cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -DSW_SSE2 -c global_sse2.c initfa.c: In function ‘alloc_pam2p’: initfa.c:2001:46: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘unsigned int’ [-Wformat=] 2001 | "Cannot reallocate pam2p[0]: %ld\n", (nsq+1)*len*sizeof(int)); | ~~^ ~~~~~~~~~~~~~~~~~~~~~~~ | | | | long int unsigned int | %d cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -g -O2 -ffile-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -flto -O3 -DSIMDE_ENABLE_OPENMP -fopenmp-simd -DSHOW_HELP -DSHOWSIM -DUNIX -DTIMES -DHZ=100 -DMAX_WORKERS=8 -DTHR_EXIT=pthread_exit -DM10_CONS -D_REENTRANT -DHAS_INTTYPES -D_LARGEFILE_SOURCE -D_FILE_OFFSET_BITS=64 -DUSE_FSEEKO -DSAMP_STATS -DPGM_DOC -DUSE_MMAP -D_LARGEFILE64_SOURCE -DBIG_LIB64 -o ../bin/map_db map_db.c map_db.c: In function ‘main’: map_db.c:149:5: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 149 | fgets(lname,sizeof(lname),stdin); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ map_db.c: In function ‘gbf_get_ent’: map_db.c:512:3: warning: ignoring return value of ‘fgets’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 512 | fgets(lline,MAXLINE,libf); | ^~~~~~~~~~~~~~~~~~~~~~~~~ map_db.c: In function ‘src_int4_read’: map_db.c:524:3: warning: ignoring return value of ‘fread’ declared with attribute ‘warn_unused_result’ [-Wunused-result] 524 | fread((char *)&b[0],(size_t)1,(size_t)4,fd); | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fasta36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fa.o drop_nfa.o wm_align.o calcons_fa.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm -lpthread cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/ssearch36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_sw_sse.o dropgsw2_sse.o smith_waterman_sse2.o lwm_align.o calcons_sw.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm -lpthread cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/lalign36 comp_mlib9.o compacc2_s.o showbest.o build_ares.o re_getlib.o lshowalign.o htime.o apam.o doinit.o init_lal.o droplal2_sse.o smith_waterman_sse2.o lsim4.o calcons_la.o scale_se.o karlin.o last_thresh.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 2 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch] 250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn, | ^ initfa.c:2036:1: note: type mismatch in parameter 6 2036 | last_calc( | ^ initfa.c:2036:1: note: ‘last_calc’ was previously declared here mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 5 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 2 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch] 250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn, | ^ initfa.c:2036:1: note: type mismatch in parameter 6 2036 | last_calc( | ^ initfa.c:2036:1: note: ‘last_calc’ was previously declared here mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 5 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 2 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 5 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fasts36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fs.o drop_fs2.o calcons_fs.o scaleswts.o last_tat.o tatstats_fs.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 2 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch] 236 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: type mismatch in parameter 7 164 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: ‘process_hist’ was previously declared here scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 5 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used initfa.c: In function ‘get_lambda.constprop’: initfa.c:2224:24: warning: argument 1 value ‘2294967297’ exceeds maximum object size 2147483647 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^ /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^ initfa.c: In function ‘get_lambda.constprop’: initfa.c:2224:24: warning: argument 1 value ‘2294967297’ exceeds maximum object size 2147483647 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^ /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^ /usr/bin/ld: /tmp/ccSKOkVo.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fastx36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fx.o drop_fx.o faatran.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 2 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch] 250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn, | ^ initfa.c:2036:1: note: type mismatch in parameter 6 2036 | last_calc( | ^ initfa.c:2036:1: note: ‘last_calc’ was previously declared here mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 5 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/ccjbkk68.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/tfastx36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfx.o drop_tfx.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o url_subs.o mrandom.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 2 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch] 250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn, | ^ initfa.c:2036:1: note: type mismatch in parameter 6 2036 | last_calc( | ^ initfa.c:2036:1: note: ‘last_calc’ was previously declared here mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 5 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/cc3p48V2.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' /usr/bin/ld: /tmp/cc3BFNUk.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fasty36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fy.o drop_fz.o faatran.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o -lm -lpthread cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/tfasty36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfy.o drop_tfz.o scale_se.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o url_subs.o mrandom.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 2 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch] 250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn, | ^ initfa.c:2036:1: note: type mismatch in parameter 6 2036 | last_calc( | ^ initfa.c:2036:1: note: ‘last_calc’ was previously declared here mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 5 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 2 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch] 250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn, | ^ initfa.c:2036:1: note: type mismatch in parameter 6 2036 | last_calc( | ^ initfa.c:2036:1: note: ‘last_calc’ was previously declared here mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 5 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/ccSHmyM8.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/tfasts36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tfs.o drop_tfs.o calcons_tfs.o scaleswts.o last_tat.o tatstats_fs.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 2 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch] 236 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: type mismatch in parameter 7 164 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: ‘process_hist’ was previously declared here scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 5 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/cczUIvZP.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fastm36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_fm.o drop_fm.o calcons_fm.o scaleswts.o last_tat.o tatstats_fm.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 2 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch] 236 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: type mismatch in parameter 7 164 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: ‘process_hist’ was previously declared here scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 5 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/cciPsN2u.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/tfastm36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_s.o htime.o apam.o doinit.o init_tfm.o drop_tfm.o calcons_tfm.o scaleswts.o tatstats_fm.o last_tat.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm -lpthread /usr/bin/ld: /tmp/ccmnvQlw.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 2 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch] 236 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: type mismatch in parameter 7 164 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: ‘process_hist’ was previously declared here scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 5 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowalign2.c:85:1: warning: type of ‘buf_align_seq’ does not match original declaration [-Wlto-type-mismatch] 85 | buf_align_seq(unsigned char **aa0, int n0, | ^ compacc2e.c:3575:1: note: type mismatch in parameter 8 3575 | buf_align_seq(unsigned char **aa0, int n0, | ^ compacc2e.c:3575:1: note: ‘buf_align_seq’ was previously declared here comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/fastf36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_ff.o drop_ff2.o calcons_ff.o scaleswtf.o last_tat.o tatstats_ff.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o mrandom.o url_subs.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 2 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch] 236 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: type mismatch in parameter 7 164 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: ‘process_hist’ was previously declared here scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 5 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/ccBVlMMX.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/tfastf36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_tf.o drop_tff.o calcons_tff.o scaleswtf.o last_tat.o tatstats_ff.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o faatran.o mrandom.o url_subs.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 2 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:236:1: warning: type of ‘process_hist’ does not match original declaration [-Wlto-type-mismatch] 236 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: type mismatch in parameter 7 164 | process_hist(struct stat_str *sptr, int nstats, | ^ scaleswt.c:164:1: note: ‘process_hist’ was previously declared here scaleswt.c:164:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 5 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/ccpO6RYt.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/glsearch36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_lnw_sse.o droplnw_sse.o glocal_sse2.o gwm_align.o calcons_sw.o scale_sn.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm -lpthread /usr/bin/ld: /tmp/ccWv1URV.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 2 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch] 250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn, | ^ initfa.c:2036:1: note: type mismatch in parameter 6 2036 | last_calc( | ^ initfa.c:2036:1: note: ‘last_calc’ was previously declared here mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 5 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used /usr/bin/ld: /tmp/ccqMpNTC.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' cc -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -flto -Wdate-time -D_FORTIFY_SOURCE=2 -o ../bin/ggsearch36 comp_mthr9.o work_thr2.o pthr_subs2.o compacc2_t.o showbest.o build_ares.o re_getlib.o mshowalign2_t.o htime.o apam.o doinit.o init_gnw_sse.o dropgnw_sse.o global_sse2.o gwm_align.o calcons_sw.o scale_sn.o karlin.o lgetlib.o lgetaa_m.o c_dispn.o ncbl2_mlib.o lib_sel.o url_subs.o mrandom.o pssm_asn_subs.o -lm -lpthread compacc2e.c:954:1: warning: type of ‘re_openlib’ does not match original declaration [-Wlto-type-mismatch] 954 | re_openlib(struct lmf_str *, int outtty); | ^ nmgetlib.c:503:3: note: type mismatch in parameter 2 503 | re_openlib(struct lmf_str *om_fptr, struct lib_struct *lib_p, int outtty) | ^ nmgetlib.c:503:3: note: ‘re_openlib’ was previously declared here nmgetlib.c:503:3: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used mshowbest.c:63:1: warning: type of ‘s_annot_to_aa1a’ does not match original declaration [-Wlto-type-mismatch] 63 | s_annot_to_aa1a(int n1, struct annot_str *annot_p, unsigned char *ann_arr); | ^ compacc2e.c:2290:1: note: type mismatch in parameter 2 2290 | s_annot_to_aa1a(long offset, int n1, struct annot_str *annot_p, unsigned char *ann_arr, char *tmp_line) { | ^ compacc2e.c:2290:1: note: ‘s_annot_to_aa1a’ was previously declared here compacc2e.c:2290:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:250:5: warning: type of ‘last_calc’ does not match original declaration [-Wlto-type-mismatch] 250 | int last_calc( unsigned char **aa0, unsigned char *aa1, int maxn, | ^ initfa.c:2036:1: note: type mismatch in parameter 6 2036 | last_calc( | ^ initfa.c:2036:1: note: ‘last_calc’ was previously declared here mshowbest.c:82:1: warning: type of ‘get_annot’ does not match original declaration [-Wlto-type-mismatch] 82 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: type mismatch in parameter 5 2178 | get_annot(char *sname, struct mngmsg *m_msp, char *bline, long offset, int n1, struct annot_str **annot_p, | ^ compacc2e.c:2178:1: note: ‘get_annot’ was previously declared here compacc2e.c:2178:1: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used comp_lib9.c:287:1: warning: type of ‘showalign’ does not match original declaration [-Wlto-type-mismatch] 287 | showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1, int maxn, | ^ mshowalign2.c:134:6: note: ‘showalign’ was previously declared here 134 | void showalign (FILE *fp, unsigned char **aa0, unsigned char *aa1save, int maxn, | ^ mshowalign2.c:134:6: note: code may be misoptimized unless ‘-fno-strict-aliasing’ is used initfa.c: In function ‘get_lambda.constprop’: initfa.c:2224:24: warning: argument 1 value ‘2294967297’ exceeds maximum object size 2147483647 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^ /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^ initfa.c: In function ‘get_lambda.constprop’: initfa.c:2224:24: warning: argument 1 value ‘2294967297’ exceeds maximum object size 2147483647 [-Walloc-size-larger-than=] 2224 | if ((pr = (double *) calloc(max - min + 1, sizeof(double))) == NULL) { | ^ /usr/include/stdlib.h:542:14: note: in a call to allocation function ‘calloc’ declared here 542 | extern void *calloc (size_t __nmemb, size_t __size) | ^ /usr/bin/ld: /tmp/cczBbpTQ.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' /usr/bin/ld: /tmp/ccvxnvmV.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' /usr/bin/ld: /tmp/ccuT3DE5.ltrans0.ltrans.o: in function `main': /<>/src/compacc2e.c:1582: warning: the use of `mktemp' is dangerous, better use `mkstemp' or `mkdtemp' make[2]: Leaving directory '/<>/src' # convoluted, but necessary to allow cross builds make[1]: Leaving directory '/<>' debian/rules override_dh_auto_test make[1]: Entering directory '/<>' cd test ; ./test2G.sh && ./test.sh && ../bin/fasta36 -q ../seq/mgstm1.aa ../seq/prot_test.lseg STARTING FASTA36 Tue Oct 19 22:45:05 UTC 2021 on bos02-arm64-054 Linux bos02-arm64-054 4.15.0-159-generic #167-Ubuntu SMP Mon Sep 20 23:06:52 UTC 2021 armv7l armv7l armv7l GNU/Linux starting prss36(ssearch/fastx) Tue Oct 19 22:45:05 UTC 2021 done starting lalign36 Tue Oct 19 22:45:06 UTC 2021 FINISHED Tue Oct 19 22:49:25 UTC 2021 STARTING FASTA36 Tue Oct 19 22:49:25 UTC 2021 on bos02-arm64-054 Linux bos02-arm64-054 4.15.0-159-generic #167-Ubuntu SMP Mon Sep 20 23:06:52 UTC 2021 armv7l armv7l armv7l GNU/Linux starting prss36(ssearch/fastx) Tue Oct 19 22:49:25 UTC 2021 done starting lalign36 Tue Oct 19 22:49:26 UTC 2021 FINISHED Tue Oct 19 22:53:50 UTC 2021 # ../bin/fasta36 -q ../seq/mgstm1.aa ../seq/prot_test.lseg FASTA searches a protein or DNA sequence data bank version 36.3.8h Aug, 2019 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: ../seq/mgstm1.aa 1>>>sp|P10649|GSTM1_MOUSE Glutathione S-transferase Mu 1; GST 1-1; GST class-mu 1; Glutathione S-transferase GT8.7; pmGT10 - 218 aa Library: ../seq/prot_test.lseg 2267 residues in 12 sequences Statistics: (shuffled [474]) MLE statistics: Lambda= 0.1565; K=0.003947 statistics sampled from 4 (4) to 473 sequences Algorithm: FASTA (3.8 Nov 2011) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.667), E-opt: 0.2 (0.333), width: 16 Scan time: 0.000 The best scores are: opt bits E(12) sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu ( 218) 1242 290.1 2.6e-82 sp|P00502|GSTA1_RAT Glutathione S-transferase alph ( 222) 237 63.3 5.2e-14 sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Ho ( 142) 51 21.3 0.15 sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinas ( 351) 43 19.5 1.2 sp|P14960|RBS_GUITH Ribulose bisphosphate carboxyl ( 139) 36 17.9 1.4 sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG ( 108) 31 16.8 2.3 sp|P99998|CYC_PANTR Cytochrome c OS=Pan troglodyte ( 105) 30 16.5 2.6 sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle ( 160) 30 16.5 3.7 sp|P60615|NXL1A_BUNMU Alpha-bungarotoxin isoform A ( 95) 26 15.6 4 sp|P00193|FER_PEPAS Ferredoxin OS=Peptostreptococc ( 54) 22 14.7 4.2 sp|P03435|HEMA_I75A3 Hemagglutinin OS=Influenza A ( 567) 37 18.1 4.2 sp|P01834|IGKC_HUMAN Ig kappa chain C region OS=Ho ( 106) 23 15.0 6.2 >>sp|P09488|GSTM1_HUMAN Glutathione S-transferase Mu 1 O (218 aa) initn: 1242 init1: 1242 opt: 1242 Z-score: 1529.6 bits: 290.1 E(12): 2.6e-82 Smith-Waterman score: 1242; 78.0% identity (95.4% similar) in 218 aa overlap (1-218:1-218) 10 20 30 40 50 60 sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNL ::::::::..:::.: ::.:::::::::.::.::::::::.::::::::::::::::::: sp|P09 MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL 10 20 30 40 50 60 70 80 90 100 110 120 sp|P10 PYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDF ::::::.:::::::::: :.::::.: ::::::.::.::.:::.::..::: :.::::.: sp|P09 PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF 70 80 90 100 110 120 130 140 150 160 170 180 sp|P10 EKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPN :: ::..:. .:::.:::::::::::::::.:.:.::::.::.:: .:.::::::::::: sp|P09 EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN 130 140 150 160 170 180 190 200 210 sp|P10 LRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK :.::..:::::.::::::::::.. :.::::: :.:: sp|P09 LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK 190 200 210 >>sp|P00502|GSTA1_RAT Glutathione S-transferase alpha-1 (222 aa) initn: 204 init1: 73 opt: 237 Z-score: 303.3 bits: 63.3 E(12): 5.2e-14 Smith-Waterman score: 237; 27.4% identity (57.0% similar) in 223 aa overlap (4-218:6-218) 10 20 30 40 50 sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKL--GLD .: :.:.:: . :: :: . .::: : .: ::.: .: sp|P00 MSGKPVLHYFNARGRMECIRWLLAAAGVEFDEK---------FIQSPEDLEKLKKDGNLM 10 20 30 40 50 60 70 80 90 100 110 sp|P10 FPNLPYL-IDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMD-TRMQLIML : ..:.. ::: :..:. ::: :.: :. : :. .:: :. . ..: :.: . .. sp|P00 FDQVPMVEIDG-MKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLV 60 70 80 90 100 110 120 130 140 150 160 170 sp|P10 CYNPDFEKQKPEFLK--TIPEKMKLYSEFLGK--RPWFAGDKVTYVDFLAYDILDQYRMF :: .. : . : : . . . . : . . ...:...: ::. ..: . : sp|P00 ICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEF 120 130 140 150 160 170 180 190 200 210 sp|P10 EPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK . . : .:: :. : .:. .: ... ... . :. .:. . . : sp|P00 DASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF 180 190 200 210 220 >>sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo s (142 aa) initn: 40 init1: 40 opt: 51 Z-score: 79.9 bits: 21.3 E(12): 0.15 Smith-Waterman score: 51; 25.6% identity (69.2% similar) in 39 aa overlap (177-214:36-73) 150 160 170 180 190 200 sp|P10 WFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKS-SRYIA .::. . .. .:. :.. :: .:. .. .: sp|P69 ADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFD-LSHGSAQVKGHGKKVA 10 20 30 40 50 60 210 sp|P10 TPIFSKMAHWSNK . . .:: sp|P69 DALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHA 70 80 90 100 110 120 >>sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase ca (351 aa) initn: 43 init1: 43 opt: 43 Z-score: 63.0 bits: 19.5 E(12): 1.2 Smith-Waterman score: 54; 23.6% identity (47.2% similar) in 72 aa overlap (137-206:229-300) 110 120 130 140 150 160 sp|P10 TRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQ .: : :.:: . . . .. . sp|P00 LCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRF 200 210 220 230 240 250 170 180 190 200 210 sp|P10 YRMFEPKCLDAFPNLR--DFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK : : . :: :. :: .::. .:. ...:: sp|P00 PSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPK 260 270 280 290 300 310 sp|P00 FKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF 320 330 340 350 >>sp|P14960|RBS_GUITH Ribulose bisphosphate carboxylase (139 aa) initn: 56 init1: 36 opt: 36 Z-score: 61.7 bits: 17.9 E(12): 1.4 Smith-Waterman score: 36; 57.1% identity (85.7% similar) in 7 aa overlap (7-13:47-53) 10 20 30 sp|P10 MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMG ::.. :: sp|P14 EQIVKQIQYAISKNWALNVEWTDDPHPRNAYWDLWGLPLFGIKDPAAVMFEINACRKAKP 20 30 40 50 60 70 40 50 60 70 80 90 sp|P10 DAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIR sp|P14 ACYVKVNAFDNSRGVESCCLSFIVQRPTSNEPGFQLIRSEVDSRNIRYTIQSYASTRPEG 80 90 100 110 120 130 >>sp|P01593|KV101_HUMAN Ig kappa chain V-I region AG OS= (108 aa) initn: 31 init1: 31 opt: 31 Z-score: 57.6 bits: 16.8 E(12): 2.3 Smith-Waterman score: 33; 36.0% identity (54.0% similar) in 50 aa overlap (150-190:16-64) 120 130 140 150 160 170 sp|P10 FEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDI---LDQYRMFE---PK ::.:: . . :: :. :.. :: sp|P01 DIQMTQSPSSLSASVGDRVTITCQASQDINHYLNWYQQGPKKAPK 10 20 30 40 180 190 200 210 sp|P10 CL--DAFPNLRDFL-ARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK : :: ::. . .:: : sp|P01 ILIYDA-SNLETGVPSRFSGSGFGTDFTFTISGLQPEDIATYYCQQYDTLPRTFGQGTKL 50 60 70 80 90 100 >>sp|P99998|CYC_PANTR Cytochrome c OS=Pan troglodytes GN (105 aa) initn: 30 init1: 30 opt: 30 Z-score: 56.6 bits: 16.5 E(12): 2.6 Smith-Waterman score: 36; 26.5% identity (54.4% similar) in 68 aa overlap (129-193:28-88) 100 110 120 130 140 150 sp|P10 IVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWF---AGDKVTY :: :. :... :. : . :..: sp|P99 MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKG 10 20 30 40 50 160 170 180 190 200 210 sp|P10 VDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHW . . . : : .: . .:: .:. . . : :.:: sp|P99 I-IWGEDTLMEY-LENPK--KYIPGTKMI---FVGIKKKEERADLIAYLKKATNE 60 70 80 90 100 sp|P10 SNK >>sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=H (160 aa) initn: 30 init1: 30 opt: 30 Z-score: 53.3 bits: 16.5 E(12): 3.7 Smith-Waterman score: 41; 25.9% identity (63.0% similar) in 54 aa overlap (44-92:13-62) 20 30 40 50 60 70 sp|P10 THPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKIT-- :. . .:: ..:. . ::. :. sp|P02 MTDQQAEARSYLSEEMIAEFKAAFDM----FDADGGGDISVK 10 20 30 80 90 100 110 120 sp|P10 QSNAILRYLAR---KHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFL . ....:.:.. :..::. :: sp|P02 ELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAE 40 50 60 70 80 90 >>sp|P60615|NXL1A_BUNMU Alpha-bungarotoxin isoform A31 O (95 aa) initn: 26 init1: 26 opt: 26 Z-score: 52.5 bits: 15.6 E(12): 4 Smith-Waterman score: 30; 54.5% identity (63.6% similar) in 11 aa overlap (115-125:86-94) 90 100 110 120 130 140 sp|P10 HLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGK : :: ::.: sp|P60 SRGKVVELGCAATCPSKKPYEEVTCCSTDKC-NPH-PKQRPG 60 70 80 90 150 160 170 180 190 200 sp|P10 RPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYI >>sp|P00193|FER_PEPAS Ferredoxin OS=Peptostreptococcus a (54 aa) initn: 22 init1: 22 opt: 22 Z-score: 52.0 bits: 14.7 E(12): 4.2 Smith-Waterman score: 25; 50.0% identity (100.0% similar) in 4 aa overlap (171-174:15-18) 150 160 170 180 190 200 sp|P10 FLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKS .:.: sp|P00 AYVINDSCIACGACKPECPVNIQQGSIYAIDADSCIDCGSCASV 10 20 30 40 210 sp|P10 SRYIATPIFSKMAHWSNK sp|P00 CPVGAPNPED 50 >>sp|P03435|HEMA_I75A3 Hemagglutinin OS=Influenza A viru (567 aa) initn: 37 init1: 37 opt: 37 Z-score: 52.0 bits: 18.1 E(12): 4.2 Smith-Waterman score: 50; 28.2% identity (64.1% similar) in 39 aa overlap (74-111:399-437) 50 60 70 80 90 100 sp|P10 SQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARK-HHLDGETEEERIRADIVEN : ... .: :... : : . : . .:. sp|P03 GFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEK 370 380 390 400 410 420 110 120 130 140 150 160 sp|P10 QVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYD : ::...: sp|P03 YVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYH 430 440 450 460 470 480 >>sp|P01834|IGKC_HUMAN Ig kappa chain C region OS=Homo s (106 aa) initn: 23 init1: 23 opt: 23 Z-score: 48.0 bits: 15.0 E(12): 6.2 Smith-Waterman score: 35; 18.3% identity (53.5% similar) in 71 aa overlap (58-124:12-82) 30 40 50 60 70 80 sp|P10 YDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKIT--QSNAILRYLARKHH :. : .:. ... .: : . . sp|P01 TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK 10 20 30 40 90 100 110 120 130 140 sp|P10 LDGETEEERIRADIVENQVMDTRMQL--IMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLG .:. . . ...:.. :. ..: . . :.::.: sp|P01 VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSF 50 60 70 80 90 100 150 160 170 180 190 200 sp|P10 KRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRY sp|P01 NRGEC 218 residues in 1 query sequences 2267 residues in 12 library sequences Tcomplib [36.3.8h Aug, 2019] (4 proc in memory [0G]) start: Tue Oct 19 22:53:50 2021 done: Tue Oct 19 22:53:50 2021 Total Scan time: 0.000 Total Display time: 0.020 Function used was FASTA [36.3.8h Aug, 2019] make[1]: Leaving directory '/<>' create-stamp debian/debhelper-build-stamp dh_testroot -a -O--sourcedirectory=src dh_prep -a -O--sourcedirectory=src dh_auto_install -a -O--sourcedirectory=src dh_install -a -O--sourcedirectory=src dh_installdocs -a -O--sourcedirectory=src dh_installchangelogs -a -O--sourcedirectory=src dh_installexamples -a -O--sourcedirectory=src dh_installman -a -O--sourcedirectory=src dh_installsystemduser -a -O--sourcedirectory=src dh_perl -a -O--sourcedirectory=src dh_link -a -O--sourcedirectory=src dh_strip_nondeterminism -a -O--sourcedirectory=src debian/rules override_dh_compress make[1]: Entering directory '/<>' dh_compress --exclude=.pdf make[1]: Leaving directory '/<>' dh_fixperms -a -O--sourcedirectory=src dh_missing -a -O--sourcedirectory=src dh_dwz -a -a -O--sourcedirectory=src dh_strip -a -a -O--sourcedirectory=src debugedit: debian/fasta3/usr/bin/fastx36: Unknown DWARF DW_FORM_0x1f21 53cd954eda03f305e9919add904781f0c4ab44e8 debugedit: debian/fasta3/usr/bin/fasts36: Unknown DWARF DW_FORM_0x1f20 50650da09ba7653a176ed4b97dc0eab612fb8462 debugedit: debian/fasta3/usr/bin/fastf36: Unknown DWARF DW_FORM_0x1f20 5eb2ad627f7f6c34ba62d21dfe24118a71eeb98d debugedit: debian/fasta3/usr/bin/fasta36: Unknown DWARF DW_FORM_0x1f20 e36d1d87f7f49ed5e9680002aa6af6baa303de48 debugedit: debian/fasta3/usr/bin/ggsearch36: Unknown DWARF DW_FORM_0x1f20 a9c3d85be65213c1d20dbdbaa8b2ae366ad52fbc debugedit: debian/fasta3/usr/bin/fasty36: Unknown DWARF DW_FORM_0x1f21 1b3e66e9b4dadf6b113aeb4433bdfe9ace8e8337 debugedit: debian/fasta3/usr/bin/map_db: Unknown DWARF DW_FORM_0x1f20 6035309771040ef8985959290de944156e49e8b7 debugedit: debian/fasta3/usr/bin/fastm36: Unknown DWARF DW_FORM_0x1f20 78c6242fd204c87d51c4383bdb82cb80020de33c debugedit: debian/fasta3/usr/bin/tfastm36: Unknown DWARF DW_FORM_0x1f20 f31ae8dfd218e6b72d873302deb16d06acb2adff debugedit: debian/fasta3/usr/bin/lalign36: Unknown DWARF DW_FORM_0x1f21 e6c72a7eec8e458fa5084b11895927a50b7f2762 debugedit: debian/fasta3/usr/bin/tfastx36: Unknown DWARF DW_FORM_0x1f21 31daaf2bed1b7310825eee6c46aaea9043d74693 debugedit: debian/fasta3/usr/bin/tfasty36: Unknown DWARF DW_FORM_0x1f21 fba8588a28727d20d64c89a138bd9149eda66932 debugedit: debian/fasta3/usr/bin/ssearch36: Unknown DWARF DW_FORM_0x1f20 7fbc8f8dc34e7e15429c1714c69091b868409708 debugedit: debian/fasta3/usr/bin/tfasts36: Unknown DWARF DW_FORM_0x1f20 2a999b060387c9fc2b23201e59ab848dfd982d62 debugedit: debian/fasta3/usr/bin/tfastf36: Unknown DWARF DW_FORM_0x1f20 96047bd9378df555d2cea1183f13f37f35674541 debugedit: debian/fasta3/usr/bin/glsearch36: Unknown DWARF DW_FORM_0x1f20 dadfd6d97cc6698a1ffdbeb4188820b8757bfb4c dh_makeshlibs -a -a -O--sourcedirectory=src dh_shlibdeps -a -a -O--sourcedirectory=src dh_installdeb -a -O--sourcedirectory=src dh_gencontrol -a -O--sourcedirectory=src dh_md5sums -a -O--sourcedirectory=src dh_builddeb -a -O--sourcedirectory=src /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. INFO: pkgstriptranslations version 148 INFO: pkgstriptranslations version 148 pkgstriptranslations: processing fasta3 (in debian/fasta3); do_strip: , oemstrip: pkgstriptranslations: processing fasta3-dbgsym (in debian/.debhelper/fasta3/dbgsym-root); do_strip: , oemstrip: /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. pkgmaintainermangler: Maintainer field overridden to "Ubuntu Developers " /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. pkgmaintainermangler: Maintainer field overridden to "Ubuntu Developers " /usr/bin/which: this version of `which' is deprecated; use `command -v' in scripts instead. pkgstripfiles: processing control file: debian/fasta3/DEBIAN/control, package fasta3, directory debian/fasta3 pkgstripfiles: processing control file: debian/.debhelper/fasta3/dbgsym-root/DEBIAN/control, package fasta3-dbgsym, directory debian/.debhelper/fasta3/dbgsym-root dpkg-deb: building package 'fasta3-dbgsym' in 'debian/.debhelper/scratch-space/build-fasta3/fasta3-dbgsym_36.3.8h.2020-02-11-4_armhf.deb'. pkgstripfiles: Running PNG optimization (using 4 cpus) for package fasta3 ... pkgstripfiles: No PNG files. dpkg-deb: building package 'fasta3' in '../fasta3_36.3.8h.2020-02-11-4_armhf.deb'. Renaming fasta3-dbgsym_36.3.8h.2020-02-11-4_armhf.deb to fasta3-dbgsym_36.3.8h.2020-02-11-4_armhf.ddeb dpkg-genbuildinfo --build=any dpkg-genchanges --build=any -mLaunchpad Build Daemon >../fasta3_36.3.8h.2020-02-11-4_armhf.changes dpkg-genchanges: info: binary-only arch-specific upload (source code and arch-indep packages not included) dpkg-source --after-build . dpkg-buildpackage: info: binary-only upload (no source included) -------------------------------------------------------------------------------- Build finished at 2021-10-19T22:54:14Z Finished -------- I: Built successfully +------------------------------------------------------------------------------+ | Post Build Chroot | +------------------------------------------------------------------------------+ +------------------------------------------------------------------------------+ | Changes | +------------------------------------------------------------------------------+ fasta3_36.3.8h.2020-02-11-4_armhf.changes: ------------------------------------------ Format: 1.8 Date: Thu, 09 Sep 2021 09:29:56 +0200 Source: fasta3 Binary: fasta3 Built-For-Profiles: noudeb Architecture: armhf Version: 36.3.8h.2020-02-11-4 Distribution: jammy-proposed Urgency: medium Maintainer: Launchpad Build Daemon Changed-By: Andreas Tille Description: fasta3 - tools for searching collections of biological sequences Changes: fasta3 (36.3.8h.2020-02-11-4) unstable; urgency=medium . [ Michael R. Crusoe ] * Team upload. * Install scripts, matrics, and misc scripts in /usr/share/fasta3/{scripts,data,misc} * Install all the example SQL scripts and data . [ Steffen Moeller ] * Fix watchfile to detect new versions on github (routine-update) . [ Andreas Tille ] * Standards-Version: 4.6.0 (routine-update) * debhelper-compat 13 (routine-update) * Depends: python3 Checksums-Sha1: 290e2fa2cab18fefbbe279e37d9b06127dd40b80 5184006 fasta3-dbgsym_36.3.8h.2020-02-11-4_armhf.ddeb 07206301b8de9fe410502c76dc43cbed8da98b0e 5710 fasta3_36.3.8h.2020-02-11-4_armhf.buildinfo 2f6765c0e40fe34520259326f84b87feb8711de9 885532 fasta3_36.3.8h.2020-02-11-4_armhf.deb Checksums-Sha256: c1a7baa094e2ad51cd6c3c5aad0cd50518c7dd672fb8a118b93dfaba0305eedf 5184006 fasta3-dbgsym_36.3.8h.2020-02-11-4_armhf.ddeb 3905aa7ab7c099ec4b8695a77f92bbafbcdcc5edea042b85ae02af89586f7e24 5710 fasta3_36.3.8h.2020-02-11-4_armhf.buildinfo ddb420ca24ab91dd1d6f929b8722c4d993ada1cb8e43d9de33dd5ea2ecb7f73a 885532 fasta3_36.3.8h.2020-02-11-4_armhf.deb Files: 14a7d17a326e244be0a2918c744ec586 5184006 debug optional fasta3-dbgsym_36.3.8h.2020-02-11-4_armhf.ddeb a4108588c64d88f60184e9dd4e9e4ce1 5710 science optional fasta3_36.3.8h.2020-02-11-4_armhf.buildinfo f7dfc783dc10855344221dfc8a2972c0 885532 science optional fasta3_36.3.8h.2020-02-11-4_armhf.deb +------------------------------------------------------------------------------+ | Buildinfo | +------------------------------------------------------------------------------+ Format: 1.0 Source: fasta3 Binary: fasta3 fasta3-dbgsym Architecture: armhf Version: 36.3.8h.2020-02-11-4 Checksums-Md5: 14a7d17a326e244be0a2918c744ec586 5184006 fasta3-dbgsym_36.3.8h.2020-02-11-4_armhf.ddeb f7dfc783dc10855344221dfc8a2972c0 885532 fasta3_36.3.8h.2020-02-11-4_armhf.deb Checksums-Sha1: 290e2fa2cab18fefbbe279e37d9b06127dd40b80 5184006 fasta3-dbgsym_36.3.8h.2020-02-11-4_armhf.ddeb 2f6765c0e40fe34520259326f84b87feb8711de9 885532 fasta3_36.3.8h.2020-02-11-4_armhf.deb Checksums-Sha256: c1a7baa094e2ad51cd6c3c5aad0cd50518c7dd672fb8a118b93dfaba0305eedf 5184006 fasta3-dbgsym_36.3.8h.2020-02-11-4_armhf.ddeb ddb420ca24ab91dd1d6f929b8722c4d993ada1cb8e43d9de33dd5ea2ecb7f73a 885532 fasta3_36.3.8h.2020-02-11-4_armhf.deb Build-Origin: Ubuntu Build-Architecture: armhf Build-Date: Tue, 19 Oct 2021 22:54:13 +0000 Build-Path: /<> Build-Tainted-By: merged-usr-via-aliased-dirs usr-local-has-programs Installed-Build-Depends: autoconf (= 2.71-2), automake (= 1:1.16.4-2), autopoint (= 0.21-4ubuntu3), autotools-dev (= 20180224.1+nmu1), base-files (= 12ubuntu1), base-passwd (= 3.5.52), bash (= 5.1-3ubuntu2), binutils (= 2.37-7ubuntu1), binutils-arm-linux-gnueabihf (= 2.37-7ubuntu1), binutils-common (= 2.37-7ubuntu1), bsdextrautils (= 2.36.1-8ubuntu2), bsdutils (= 1:2.36.1-8ubuntu2), build-essential (= 12.9ubuntu2), bzip2 (= 1.0.8-4ubuntu4), coreutils (= 8.32-4ubuntu3), cpp (= 4:11.2.0-1ubuntu1), cpp-11 (= 11.2.0-7ubuntu2), dash (= 0.5.11+git20210120+802ebd4-1build1), debconf (= 1.5.77), debhelper (= 13.3.4ubuntu2), debianutils (= 5.5-1), debugedit (= 1:5.0-0ubuntu2), dh-autoreconf (= 20), dh-strip-nondeterminism (= 1.12.0-1), diffutils (= 1:3.8-0ubuntu1), dpkg (= 1.20.9ubuntu2), dpkg-dev (= 1.20.9ubuntu2), dwz (= 0.14-1build1), file (= 1:5.39-3build1), findutils (= 4.8.0-1ubuntu2), g++ (= 4:11.2.0-1ubuntu1), g++-11 (= 11.2.0-7ubuntu2), gcc (= 4:11.2.0-1ubuntu1), gcc-11 (= 11.2.0-7ubuntu2), gcc-11-base (= 11.2.0-7ubuntu2), gettext (= 0.21-4ubuntu3), gettext-base (= 0.21-4ubuntu3), grep (= 3.7-0ubuntu1), groff-base (= 1.22.4-7), gzip (= 1.10-4ubuntu2), hostname (= 3.23ubuntu1), init-system-helpers (= 1.60build1), intltool-debian (= 0.35.0+20060710.5), libacl1 (= 2.2.53-10ubuntu2), libarchive-zip-perl (= 1.68-1), libasan6 (= 11.2.0-7ubuntu2), libatomic1 (= 11.2.0-7ubuntu2), libattr1 (= 1:2.5.1-1), libaudit-common (= 1:3.0-2ubuntu3), libaudit1 (= 1:3.0-2ubuntu3), libbinutils (= 2.37-7ubuntu1), libblkid1 (= 2.36.1-8ubuntu2), libbz2-1.0 (= 1.0.8-4ubuntu4), libc-bin (= 2.34-0ubuntu3), libc-dev-bin (= 2.34-0ubuntu3), libc6 (= 2.34-0ubuntu3), libc6-dev (= 2.34-0ubuntu3), libcap-ng0 (= 0.7.9-2.2build2), libcap2 (= 1:2.44-1build2), libcc1-0 (= 11.2.0-7ubuntu2), libcom-err2 (= 1.46.3-1ubuntu3), libcrypt-dev (= 1:4.4.18-4ubuntu2), libcrypt1 (= 1:4.4.18-4ubuntu2), libctf-nobfd0 (= 2.37-7ubuntu1), libctf0 (= 2.37-7ubuntu1), libdb5.3 (= 5.3.28+dfsg1-0.8ubuntu2), libdebconfclient0 (= 0.256ubuntu4), libdebhelper-perl (= 13.3.4ubuntu2), libdpkg-perl (= 1.20.9ubuntu2), libdw1 (= 0.185-2), libelf1 (= 0.185-2), libfile-stripnondeterminism-perl (= 1.12.0-1), libgcc-11-dev (= 11.2.0-7ubuntu2), libgcc-s1 (= 11.2.0-7ubuntu2), libgcrypt20 (= 1.8.7-5ubuntu2), libgdbm-compat4 (= 1.21-1), libgdbm6 (= 1.21-1), libgmp10 (= 2:6.2.1+dfsg-1ubuntu3), libgomp1 (= 11.2.0-7ubuntu2), libgpg-error0 (= 1.42-3), libgssapi-krb5-2 (= 1.18.3-7), libicu67 (= 67.1-7ubuntu1), libisl23 (= 0.24-2), libk5crypto3 (= 1.18.3-7), libkeyutils1 (= 1.6.1-2ubuntu2), libkrb5-3 (= 1.18.3-7), libkrb5support0 (= 1.18.3-7), liblz4-1 (= 1.9.3-2build1), liblzma5 (= 5.2.5-2build1), libmagic-mgc (= 1:5.39-3build1), libmagic1 (= 1:5.39-3build1), libmount1 (= 2.36.1-8ubuntu2), libmpc3 (= 1.2.1-1), libmpfr6 (= 4.1.0-3build2), libnsl-dev (= 1.3.0-2build1), libnsl2 (= 1.3.0-2build1), libpam-modules (= 1.3.1-5ubuntu11), libpam-modules-bin (= 1.3.1-5ubuntu11), libpam-runtime (= 1.3.1-5ubuntu11), libpam0g (= 1.3.1-5ubuntu11), libpcre2-8-0 (= 10.37-0ubuntu2), libpcre3 (= 2:8.39-13build4), libperl5.32 (= 5.32.1-3ubuntu3), libpipeline1 (= 1.5.3-1build1), libseccomp2 (= 2.5.1-1ubuntu2), libselinux1 (= 3.1-3build3), libsigsegv2 (= 2.13-1ubuntu2), libsimde-dev (= 0.7.2-4), libsmartcols1 (= 2.36.1-8ubuntu2), libssl1.1 (= 1.1.1l-1ubuntu1), libstdc++-11-dev (= 11.2.0-7ubuntu2), libstdc++6 (= 11.2.0-7ubuntu2), libsub-override-perl (= 0.09-2), libsystemd0 (= 248.3-1ubuntu8), libtinfo6 (= 6.2+20210905-1), libtirpc-common (= 1.3.2-2), libtirpc-dev (= 1.3.2-2), libtirpc3 (= 1.3.2-2), libtool (= 2.4.6-15build1), libubsan1 (= 11.2.0-7ubuntu2), libuchardet0 (= 0.0.7-1build1), libudev1 (= 248.3-1ubuntu8), libunistring2 (= 0.9.10-6), libuuid1 (= 2.36.1-8ubuntu2), libxml2 (= 2.9.12+dfsg-5), libzstd1 (= 1.4.8+dfsg-3), linux-libc-dev (= 5.13.0-19.19), login (= 1:4.8.1-1ubuntu9), lsb-base (= 11.1.0ubuntu3), lto-disabled-list (= 16), m4 (= 1.4.18-5ubuntu1), make (= 4.3-4ubuntu2), man-db (= 2.9.4-2build1), mawk (= 1.3.4.20200120-2build1), ncurses-base (= 6.2+20210905-1), ncurses-bin (= 6.2+20210905-1), patch (= 2.7.6-7build1), perl (= 5.32.1-3ubuntu3), perl-base (= 5.32.1-3ubuntu3), perl-modules-5.32 (= 5.32.1-3ubuntu3), po-debconf (= 1.0.21+nmu1), rpcsvc-proto (= 1.4.2-0ubuntu5), sed (= 4.7-1ubuntu2), sensible-utils (= 0.0.17), sysvinit-utils (= 2.96-7ubuntu2), tar (= 1.34+dfsg-1build2), util-linux (= 2.36.1-8ubuntu2), xz-utils (= 5.2.5-2build1), zlib1g (= 1:1.2.11.dfsg-2ubuntu7) Environment: DEB_BUILD_OPTIONS="parallel=4" DEB_BUILD_PROFILES="noudeb" LANG="C.UTF-8" LC_ALL="C.UTF-8" SOURCE_DATE_EPOCH="1631172596" +------------------------------------------------------------------------------+ | Package contents | +------------------------------------------------------------------------------+ fasta3_36.3.8h.2020-02-11-4_armhf.deb ------------------------------------- new Debian package, version 2.0. size 885532 bytes: control archive=5872 bytes. 2231 bytes, 54 lines control 13535 bytes, 183 lines md5sums Package: fasta3 Version: 36.3.8h.2020-02-11-4 Architecture: armhf Maintainer: Ubuntu Developers Original-Maintainer: Debian Med Packaging Team Installed-Size: 4853 Depends: libc6 (>= 2.34), python3 Suggests: perl:any, libdbi-perl, libwww-perl, libjson-perl, libhtml-tableextract-perl, libxml-twig-perl, liburi-encode-perl, libdbd-mysql-perl, python3-mysqldb, ncbi-blast+, bedtools Section: science Priority: optional Homepage: https://fasta.bioch.virginia.edu Description: tools for searching collections of biological sequences The FASTA programs find regions of local or global similarity between Protein or DNA sequences, either by searching Protein or DNA databases, or by identifying local duplications within a sequence. Other programs provide information on the statistical significance of an alignment. Like BLAST, FASTA can be used to infer functional and evolutionary relationships between sequences as well as help identify members of gene families. . * Protein - Protein-protein FASTA - Protein-protein Smith-Waterman (ssearch) - Global Protein-protein (Needleman-Wunsch) (ggsearch) - Global/Local protein-protein (glsearch) - Protein-protein with unordered peptides (fasts) - Protein-protein with mixed peptide sequences (fastf) . * Nucleotide - Nucleotide-Nucleotide (DNA/RNA fasta) - Ordered Nucleotides vs Nucleotide (fastm) - Un-ordered Nucleotides vs Nucleotide (fasts) . * Translated - Translated DNA (with frameshifts, e.g. ESTs) vs Proteins (fastx/fasty) - Protein vs Translated DNA (with frameshifts) (tfastx/tfasty) - Peptides vs Translated DNA (tfasts) . * Statistical Significance - Protein vs Protein shuffle (prss) - DNA vs DNA shuffle (prss) - Translated DNA vs Protein shuffle (prfx) . * Local Duplications - Local Protein alignments (lalign) - Plot Protein alignment "dot-plot" (plalign) - Local DNA alignments (lalign) - Plot DNA alignment "dot-plot" (plalign) . This software is often used via a web service at the EBI with readily indexed reference databases at http://www.ebi.ac.uk/Tools/fasta/. drwxr-xr-x root/root 0 2021-09-09 07:29 ./ drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/ drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/bin/ -rwxr-xr-x root/root 264076 2021-09-09 07:29 ./usr/bin/fasta36 -rwxr-xr-x root/root 225688 2021-09-09 07:29 ./usr/bin/fastf36 -rwxr-xr-x root/root 229720 2021-09-09 07:29 ./usr/bin/fastm36 -rwxr-xr-x root/root 229720 2021-09-09 07:29 ./usr/bin/fasts36 -rwxr-xr-x root/root 260052 2021-09-09 07:29 ./usr/bin/fastx36 -rwxr-xr-x root/root 264148 2021-09-09 07:29 ./usr/bin/fasty36 -rwxr-xr-x root/root 300780 2021-09-09 07:29 ./usr/bin/ggsearch36 -rwxr-xr-x root/root 300780 2021-09-09 07:29 ./usr/bin/glsearch36 -rwxr-xr-x root/root 280364 2021-09-09 07:29 ./usr/bin/lalign36 -rwxr-xr-x root/root 9820 2021-09-09 07:29 ./usr/bin/map_db -rwxr-xr-x root/root 284524 2021-09-09 07:29 ./usr/bin/ssearch36 -rwxr-xr-x root/root 230056 2021-09-09 07:29 ./usr/bin/tfastf36 -rwxr-xr-x root/root 229992 2021-09-09 07:29 ./usr/bin/tfastm36 -rwxr-xr-x root/root 229992 2021-09-09 07:29 ./usr/bin/tfasts36 -rwxr-xr-x root/root 260052 2021-09-09 07:29 ./usr/bin/tfastx36 -rwxr-xr-x root/root 264148 2021-09-09 07:29 ./usr/bin/tfasty36 drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/ drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/doc/ drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/doc/fasta3/ -rw-r--r-- root/root 1274 2021-09-09 07:29 ./usr/share/doc/fasta3/changelog.Debian.gz -rw-r--r-- root/root 2874 2021-09-09 07:29 ./usr/share/doc/fasta3/copyright drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/doc/fasta3/examples/ drwxr-xr-x root/root 0 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/ -rw-r--r-- root/root 2528 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/bovgh.seq -rw-r--r-- root/root 986 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/bovprl.seq -rw-r--r-- root/root 3159 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/dna_test_s.nlib -rw-r--r-- root/root 261 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/dyr_human.aa -rw-r--r-- root/root 1286 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/egmsmg.aa -rw-r--r-- root/root 806 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/grou_drome.pseg -rw-r--r-- root/root 18633 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gst.nlib -rw-r--r-- root/root 1405 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gst.seq -rw-r--r-- root/root 309 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gstm1_human.vaa -rw-r--r-- root/root 1226 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gstm1b_human.nt -rw-r--r-- root/root 1226 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gstm1b_human_fs.nt -rw-r--r-- root/root 314 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gstt1_drome.aa -rw-r--r-- root/root 311 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gtm1_human.aa -rw-r--r-- root/root 291 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/gtt1_drome.aa -rw-r--r-- root/root 247 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/h10_human.aa -rw-r--r-- root/root 225 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/hahu.aa -rw-r--r-- root/root 7118 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/hsgstm1b.gcg -rw-r--r-- root/root 2788 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/hsgstm1b.seq -rw-r--r-- root/root 1323 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/humgstd.seq -rw-r--r-- root/root 271 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/lcbo.aa -rw-r--r-- root/root 56 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/m1r.aa -rw-r--r-- root/root 50 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/m2.aa -rw-r--r-- root/root 189 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mchu.aa -rw-r--r-- root/root 3440 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.3nt -rw-r--r-- root/root 342 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.aa -rw-r--r-- root/root 310 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.aaa -rw-r--r-- root/root 1220 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.e05 -rw-r--r-- root/root 1122 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.eeq -rw-r--r-- root/root 1116 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.esq -rw-r--r-- root/root 406 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.gcg -rw-r--r-- root/root 282 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.lc -rw-r--r-- root/root 677 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt -rw-r--r-- root/root 682 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt1 -rw-r--r-- root/root 1352 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt12r -rw-r--r-- root/root 2033 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt13 -rw-r--r-- root/root 2028 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt13r -rw-r--r-- root/root 681 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nt1r -rw-r--r-- root/root 160 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.nts -rw-r--r-- root/root 259 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.raa -rw-r--r-- root/root 1167 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.rev -rw-r--r-- root/root 1158 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1.seq -rw-r--r-- root/root 148692 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgstm1_genclone.seq -rw-r--r-- root/root 1286 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mgtt2_x.seq -rw-r--r-- root/root 43 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/ms1.aa -rw-r--r-- root/root 2361 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mu.lib -rw-r--r-- root/root 275 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/musplfm.aa -rw-r--r-- root/root 2047 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mwkw.aa -rw-r--r-- root/root 500 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/mwrtc1.aa -rw-r--r-- root/root 1294 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/myosin_bp.aa -rw-r--r-- root/root 27 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n0.aa -rw-r--r-- root/root 47 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n1.aa -rw-r--r-- root/root 692 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n2.aa -rw-r--r-- root/root 1482 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n2_fs.lib -rw-r--r-- root/root 178 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n2s.aa -rw-r--r-- root/root 243 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n2t.aa -rw-r--r-- root/root 330 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/n_fs.lib -rw-r--r-- root/root 217 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/ngt.aa -rw-r--r-- root/root 111 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/ngts.aa -rw-r--r-- root/root 385 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/oohu.aa -rw-r--r-- root/root 401 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/oohu.raa -rw-r--r-- root/root 340 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/prio_atepa.aa -rw-r--r-- root/root 2741 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/prot_test.lib -rw-r--r-- root/root 3391 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/prot_test.lseg -rw-r--r-- root/root 1530 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/prot_test_s.lseg -rw-r--r-- root/root 914 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/qrhuld.aa -rw-r--r-- root/root 34874 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/titin_hum.aa -rw-r--r-- root/root 83286 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/titin_hum.seq -rw-r--r-- root/root 302 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/xurt8c.aa -rw-r--r-- root/root 302 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/xurt8c.lc -rw-r--r-- root/root 281 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/seq/xurtg.aa drwxr-xr-x root/root 0 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/ -rw-r--r-- root/root 992 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/README -rw-r--r-- root/root 536 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/create_seq_demo.sql -rwxr-xr-x root/root 3227 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/join_up50.pl -rw-r--r-- root/root 347 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/mysql_demo1.sql -rw-r--r-- root/root 388 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/mysql_demo_pv.sql -rwxr-xr-x root/root 3300 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/nr_to_sql.pl -rw-r--r-- root/root 230 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/pirpsd.sql -rw-r--r-- root/root 317 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/psql_demo.sql -rw-r--r-- root/root 373 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/psql_demo1.sql -rw-r--r-- root/root 343 2020-02-10 19:14 ./usr/share/doc/fasta3/examples/sql/psql_demo_pv.sql drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/fasta3/ drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/fasta3/data/ -rw-r--r-- root/root 2764 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_10.mat -rw-r--r-- root/root 2548 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_120.mat -rw-r--r-- root/root 2548 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_160.mat -rw-r--r-- root/root 2546 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_20.mat -rw-r--r-- root/root 2548 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_200.mat -rw-r--r-- root/root 2546 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_40.mat -rw-r--r-- root/root 2545 2020-02-10 19:14 ./usr/share/fasta3/data/VTML_80.mat -rw-r--r-- root/root 1922 2020-02-10 19:14 ./usr/share/fasta3/data/blosum45.mat -rw-r--r-- root/root 1921 2020-02-10 19:14 ./usr/share/fasta3/data/blosum50.mat -rw-r--r-- root/root 1922 2020-02-10 19:14 ./usr/share/fasta3/data/blosum62.mat -rw-r--r-- root/root 1924 2020-02-10 19:14 ./usr/share/fasta3/data/blosum80.mat -rw-r--r-- root/root 976 2020-02-10 19:14 ./usr/share/fasta3/data/dna.mat -rw-r--r-- root/root 2256 2020-02-10 19:14 ./usr/share/fasta3/data/idn_aa.mat -rw-r--r-- root/root 2255 2020-02-10 19:14 ./usr/share/fasta3/data/md_10.mat -rw-r--r-- root/root 2256 2020-02-10 19:14 ./usr/share/fasta3/data/md_20.mat -rw-r--r-- root/root 2255 2020-02-10 19:14 ./usr/share/fasta3/data/md_40.mat -rw-r--r-- root/root 1922 2020-02-10 19:14 ./usr/share/fasta3/data/pam120.mat -rw-r--r-- root/root 1923 2020-02-10 19:14 ./usr/share/fasta3/data/pam250.mat -rw-r--r-- root/root 998 2020-02-10 19:14 ./usr/share/fasta3/data/rna.mat -rw-r--r-- root/root 2771 2020-02-10 19:14 ./usr/share/fasta3/data/vtml160.mat drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/fasta3/misc/ -rw-r--r-- root/root 424 2020-02-10 19:14 ./usr/share/fasta3/misc/README -rwxr-xr-x root/root 3447 2020-02-10 19:14 ./usr/share/fasta3/misc/parse_m9.pl -rwxr-xr-x root/root 367 2020-02-10 19:14 ./usr/share/fasta3/misc/res2R.pl -rwxr-xr-x root/root 3177 2020-02-10 19:14 ./usr/share/fasta3/misc/shuffle_embed.pl drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/fasta3/scripts/ -rw-r--r-- root/root 5789 2020-02-10 19:14 ./usr/share/fasta3/scripts/README -rw-r--r-- root/root 3182 2020-02-10 19:14 ./usr/share/fasta3/scripts/README.scripts -rw-r--r-- root/root 76 2020-02-10 19:14 ./usr/share/fasta3/scripts/acc_examples -rwxr-xr-x root/root 12507 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_all.pl -rwxr-xr-x root/root 7198 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_ens.pl -rwxr-xr-x root/root 4691 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_ncbi.pl -rwxr-xr-x root/root 8501 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_up_sql.pl -rwxr-xr-x root/root 12193 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_up_sql_www.pl -rwxr-xr-x root/root 9074 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_exons_up_www.pl -rwxr-xr-x root/root 15898 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_feats2ipr.pl -rwxr-xr-x root/root 15966 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_feats2ipr_e.pl -rwxr-xr-x root/root 13489 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_feats_up_sql.pl -rwxr-xr-x root/root 12705 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_feats_up_www2.pl -rwxr-xr-x root/root 14506 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_ipr_www.pl -rwxr-xr-x root/root 9490 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_pdb_cath.pl -rwxr-xr-x root/root 8375 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_pdb_vast.pl -rwxr-xr-x root/root 27672 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_pfam30_tmptbl.pl -rwxr-xr-x root/root 27255 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_pfam_sql.pl -rwxr-xr-x root/root 20385 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_pfam_www.pl -rw-r--r-- root/root 321 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_script_list -rwxr-xr-x root/root 23627 2021-09-09 07:29 ./usr/share/fasta3/scripts/ann_upfeats_pfam_www_e.pl -rwxr-xr-x root/root 44866 2021-09-09 07:29 ./usr/share/fasta3/scripts/annot_blast_btop2.pl -rwxr-xr-x root/root 25321 2021-09-09 07:29 ./usr/share/fasta3/scripts/annot_blast_btop3.py -rwxr-xr-x root/root 26399 2021-09-09 07:29 ./usr/share/fasta3/scripts/annot_blast_btop4.py -rwxr-xr-x root/root 1779 2021-09-09 07:29 ./usr/share/fasta3/scripts/blastp_annot_cmd.sh -rwxr-xr-x root/root 753 2021-09-09 07:29 ./usr/share/fasta3/scripts/blastp_cmd.sh -rwxr-xr-x root/root 4583 2020-02-10 19:14 ./usr/share/fasta3/scripts/color_defs.pl -rwxr-xr-x root/root 4564 2021-09-09 07:29 ./usr/share/fasta3/scripts/exp_up_ensg.pl -rwxr-xr-x root/root 3275 2021-09-09 07:29 ./usr/share/fasta3/scripts/expand_links.pl -rwxr-xr-x root/root 5572 2021-09-09 07:29 ./usr/share/fasta3/scripts/expand_refseq_isoforms.pl -rwxr-xr-x root/root 2576 2021-09-09 07:29 ./usr/share/fasta3/scripts/expand_uniref50.pl -rwxr-xr-x root/root 6043 2021-09-09 07:29 ./usr/share/fasta3/scripts/expand_up_isoforms.pl -rwxr-xr-x root/root 1590 2021-09-09 07:29 ./usr/share/fasta3/scripts/fasta_annot_cmd.sh -rwxr-xr-x root/root 1676 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_genome_seq.py -rwxr-xr-x root/root 2234 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_protein.py -rwxr-xr-x root/root 1497 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_protein_sql.py -rwxr-xr-x root/root 4000 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_protein_sql_www.py -rwxr-xr-x root/root 878 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_refseq.py -rwxr-xr-x root/root 441 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_uniprot.py -rwxr-xr-x root/root 1188 2021-09-09 07:29 ./usr/share/fasta3/scripts/get_up_prot_iso_sql.py -rwxr-xr-x root/root 8976 2021-09-09 07:29 ./usr/share/fasta3/scripts/lav2plt.pl -rwxr-xr-x root/root 14885 2021-09-09 07:29 ./usr/share/fasta3/scripts/lavplt_ps.pl -rwxr-xr-x root/root 13069 2021-09-09 07:29 ./usr/share/fasta3/scripts/lavplt_svg.pl -rwxr-xr-x root/root 1909 2021-09-09 07:29 ./usr/share/fasta3/scripts/links2sql.pl -rwxr-xr-x root/root 11092 2021-09-09 07:29 ./usr/share/fasta3/scripts/m8_btop_msa.pl -rwxr-xr-x root/root 18926 2021-09-09 07:29 ./usr/share/fasta3/scripts/m9B_btop_msa.pl -rwxr-xr-x root/root 16976 2021-09-09 07:29 ./usr/share/fasta3/scripts/map_exon_coords.py -rwxr-xr-x root/root 7659 2021-09-09 07:29 ./usr/share/fasta3/scripts/merge_blast_btab.pl -rwxr-xr-x root/root 9415 2021-09-09 07:29 ./usr/share/fasta3/scripts/merge_fasta_btab.pl -rwxr-xr-x root/root 19093 2020-02-10 19:14 ./usr/share/fasta3/scripts/plot_domain2t.cgi -rwxr-xr-x root/root 5135 2021-09-09 07:29 ./usr/share/fasta3/scripts/relabel_domains.py -rwxr-xr-x root/root 30354 2021-09-09 07:29 ./usr/share/fasta3/scripts/rename_exons.py -rwxr-xr-x root/root 3042 2021-09-09 07:29 ./usr/share/fasta3/scripts/summ_domain_ident.pl -rwxr-xr-x root/root 706 2021-09-09 07:29 ./usr/share/fasta3/scripts/test_ann_scripts.sh -rwxr-xr-x root/root 2978 2021-09-09 07:29 ./usr/share/fasta3/scripts/test_py.sh drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/man/ drwxr-xr-x root/root 0 2021-09-09 07:29 ./usr/share/man/man1/ -rw-r--r-- root/root 7358 2021-09-09 07:29 ./usr/share/man/man1/fasta36.1.gz -rw-r--r-- root/root 2195 2021-09-09 07:29 ./usr/share/man/man1/fastf3.1.gz -rw-r--r-- root/root 2119 2021-09-09 07:29 ./usr/share/man/man1/fasts3.1.gz -rw-r--r-- root/root 523 2021-09-09 07:29 ./usr/share/man/man1/map_db.1.gz -rw-r--r-- root/root 2146 2021-09-09 07:29 ./usr/share/man/man1/prss3.1.gz -rw-r--r-- root/root 402 2021-09-09 07:29 ./usr/share/man/man1/ps_lav.1.gz +------------------------------------------------------------------------------+ | Post Build | +------------------------------------------------------------------------------+ +------------------------------------------------------------------------------+ | Cleanup | +------------------------------------------------------------------------------+ Purging /<> Not removing build depends: as requested +------------------------------------------------------------------------------+ | Summary | +------------------------------------------------------------------------------+ Build Architecture: armhf Build Type: any Build-Space: n/a Build-Time: 801 Distribution: jammy-proposed Host Architecture: armhf Install-Time: 23 Job: fasta3_36.3.8h.2020-02-11-4.dsc Machine Architecture: arm64 Package: fasta3 Package-Time: 827 Source-Version: 36.3.8h.2020-02-11-4 Space: n/a Status: successful Version: 36.3.8h.2020-02-11-4 -------------------------------------------------------------------------------- Finished at 2021-10-19T22:54:14Z Build needed 00:13:47, no disk space Adding user buildd to group lxd RUN: /usr/share/launchpad-buildd/bin/in-target scan-for-processes --backend=chroot --series=jammy --arch=armhf PACKAGEBUILD-22293620 Scanning for processes to kill in build PACKAGEBUILD-22293620